KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_0629Help
Entry
RA0C_0629         CDS       T02107                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, e2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
rai00020  Citrate cycle (TCA cycle)
rai00310  Lysine degradation
rai01100  Metabolic pathways
rai01110  Biosynthesis of secondary metabolites
rai01120  Microbial metabolism in diverse environments
rai01130  Biosynthesis of antibiotics
rai01200  Carbon metabolism
Module
rai_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rai_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rai00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RA0C_0629
  Amino acid metabolism
   00310 Lysine degradation
    RA0C_0629
Enzymes [BR:rai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RA0C_0629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: AFD55599
UniProt: E4T999
Position
complement(606480..607712)
Genome map
AA seq 410 aa AA seqDB search
MSILEMKVPSPGESITEVEIATWLVQDGDYVEKDQPIAEVDSDKATLELPAEESGIITLK
AEEGDVVEVGQVVCLIDMSAAKPEGGAAKQETAKVEENKEEVKAEAPKQEASPATYATGT
PSPAAKKILDEKGVEASQVKGTGRDGRITKEDAEQASVPAMGSVFATNGSRSSKTTKLSS
LRRKLAQRLVSVKNETAMLTTFNEVDMSEIFRIRKQYKEEFAAKHGVGLGFMSFFTKAVT
RALQMYPEVNSMIDGNQMITYDFCDVSVAVSGPKGLMVPVLRNAETMSFRGVEASIKELA
EKARNGKITVDEMTGGTFTITNGGVFGSMLSTPIINPPQSAILGMHNIIQRPVAVDGQVV
IRPMMYLALSYDHRIIDGRESVGFLVAVKEAIDNPVEHLLGGDERRGLEL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatattagaaatgaaagttccctctccgggagagtctattacagaagtagaaatc
gctacttggttggttcaagatggtgattatgtagaaaaagatcagcctattgcagaagta
gattctgataaggcaacgctagaacttccagctgaagaaagtggtatcattacgctaaag
gcagaagaaggcgacgtagtagaagtaggacaagtggtttgtctaattgatatgagtgcg
gctaaaccagaaggtggtgcagctaagcaagagactgctaaagtagaagaaaataaagaa
gaagttaaagcagaagctccaaaacaagaggcttctcctgcaacctatgctacaggaaca
ccgtctcctgcagctaagaaaattctagatgaaaaaggggtagaggcatctcaagtaaaa
ggaacaggtagagatggtagaattactaaagaagatgcagaacaggcttctgtaccggct
atgggttctgtatttgctactaatgggtctagatcttctaagacaactaaattatcttca
ttgagaagaaaattagctcagcgtttagtttctgttaagaatgagacggcgatgcttact
actttcaatgaggtagatatgagtgagattttcagaattagaaaacaatataaagaggag
tttgcagcgaagcacggtgtaggtttaggctttatgtctttctttacaaaggcggttact
agagcgttacaaatgtatccagaggtaaactctatgatagacggcaatcaaatgattact
tatgatttctgcgatgtttctgtggctgtatctggtcctaaagggcttatggttcctgta
cttagaaatgcagaaacaatgtctttccgtggtgtagaggctagcattaaggaactagca
gagaaggcaagaaacgggaaaattacggtagatgaaatgacaggaggaacttttactatc
actaatggtggggtatttgggtctatgctttcaacaccgattatcaatccgcctcaatct
gcaattttaggaatgcacaacattatccaaagaccagtggcagtagatgggcaagtagtt
attcgtccaatgatgtatctagcattatcttatgaccatagaattatagacggaagagaa
tctgtaggtttcttagtagcggtaaaagaagctattgataatcctgtagaacacttgcta
ggaggtgatgaaagaagaggactagagctttaa

DBGET integrated database retrieval system