KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_0629Help
Entry
RA0C_0629         CDS       T02107                                 

Definition
2-oxoglutarate dehydrogenase, e2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rai01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rai00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:rai00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(606480..607712)
Genome map
AA seq 410 aa AA seqDB search
MSILEMKVPSPGESITEVEIATWLVQDGDYVEKDQPIAEVDSDKATLELPAEESGIITLK
AEEGDVVEVGQVVCLIDMSAAKPEGGAAKQETAKVEENKEEVKAEAPKQEASPATYATGT
PSPAAKKILDEKGVEASQVKGTGRDGRITKEDAEQASVPAMGSVFATNGSRSSKTTKLSS
LRRKLAQRLVSVKNETAMLTTFNEVDMSEIFRIRKQYKEEFAAKHGVGLGFMSFFTKAVT
RALQMYPEVNSMIDGNQMITYDFCDVSVAVSGPKGLMVPVLRNAETMSFRGVEASIKELA
EKARNGKITVDEMTGGTFTITNGGVFGSMLSTPIINPPQSAILGMHNIIQRPVAVDGQVV
IRPMMYLALSYDHRIIDGRESVGFLVAVKEAIDNPVEHLLGGDERRGLEL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatattagaaatgaaagttccctctccgggagagtctattacagaagtagaaatc
gctacttggttggttcaagatggtgattatgtagaaaaagatcagcctattgcagaagta
gattctgataaggcaacgctagaacttccagctgaagaaagtggtatcattacgctaaag
gcagaagaaggcgacgtagtagaagtaggacaagtggtttgtctaattgatatgagtgcg
gctaaaccagaaggtggtgcagctaagcaagagactgctaaagtagaagaaaataaagaa
gaagttaaagcagaagctccaaaacaagaggcttctcctgcaacctatgctacaggaaca
ccgtctcctgcagctaagaaaattctagatgaaaaaggggtagaggcatctcaagtaaaa
ggaacaggtagagatggtagaattactaaagaagatgcagaacaggcttctgtaccggct
atgggttctgtatttgctactaatgggtctagatcttctaagacaactaaattatcttca
ttgagaagaaaattagctcagcgtttagtttctgttaagaatgagacggcgatgcttact
actttcaatgaggtagatatgagtgagattttcagaattagaaaacaatataaagaggag
tttgcagcgaagcacggtgtaggtttaggctttatgtctttctttacaaaggcggttact
agagcgttacaaatgtatccagaggtaaactctatgatagacggcaatcaaatgattact
tatgatttctgcgatgtttctgtggctgtatctggtcctaaagggcttatggttcctgta
cttagaaatgcagaaacaatgtctttccgtggtgtagaggctagcattaaggaactagca
gagaaggcaagaaacgggaaaattacggtagatgaaatgacaggaggaacttttactatc
actaatggtggggtatttgggtctatgctttcaacaccgattatcaatccgcctcaatct
gcaattttaggaatgcacaacattatccaaagaccagtggcagtagatgggcaagtagtt
attcgtccaatgatgtatctagcattatcttatgaccatagaattatagacggaagagaa
tctgtaggtttcttagtagcggtaaaagaagctattgataatcctgtagaacacttgcta
ggaggtgatgaaagaagaggactagagctttaa

DBGET integrated database retrieval system