KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_0668Help
Entry
RA0C_0668         CDS       T02107                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
rai00240  Pyrimidine metabolism
rai00250  Alanine, aspartate and glutamate metabolism
rai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rai00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    RA0C_0668
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RA0C_0668
Enzymes [BR:rai01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     RA0C_0668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AFD55630
UniProt: E4T9D4
Position
complement(646054..646950)
Genome map
AA seq 298 aa AA seqDB search
MLTISDLSTEKIMSLLEEAQGFTNGKIAKCQQEVYVSNLFFENSTRTKTSFDVAERKLGF
NVVPFDVSTSSVNKGETLYDTVKTLESIGVDLVVIRHSQDFYFRELETINIPIINGGDGT
GNHPSQSLLDLMTIYQEFKKFEGLKVGIVGDVKHSRVANSNAEALRRLGAKVYFSGPEDW
FDEAEFINGTYLPIDTLVKEVDVVMLLRIQHERHGEKMKLSLDKYHQKYGLTKERATQMK
PTTIIMHPAPINRGVEIDTDLVESPQSRIFKQMENGVYARMAILKQALEDKGIKFKTM
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcttacaatttcagatttatctacagagaaaattatgtctcttttagaagaggctcaa
gggtttactaatggtaaaatagccaagtgccaacaagaagtttatgtgtctaatcttttc
tttgaaaatagtacgagaaccaaaacaagttttgatgtagccgaaaggaaattgggattt
aatgttgttccttttgatgtatctacaagttcggtaaacaaaggagaaaccctttacgat
acggtaaaaactttggagagtattggagttgatttagtggtcattcgtcatagtcaggac
ttttattttagggagttggaaactattaacattcctataattaacggaggagatggcaca
ggcaatcacccttcgcaatctttgttggatttgatgacgatttatcaagaatttaaaaag
tttgaaggattaaaagtggggattgtaggcgatgttaaacacagcagggtggctaattct
aacgcagaggcactcagaaggctcggagctaaagtctatttttctggaccagaagattgg
tttgatgaagccgaatttatcaacgggacttatctgcctatagatacacttgtaaaagag
gtagatgtagtgatgcttcttcgcattcagcacgaaagacatggggagaaaatgaaatta
tctttagataaataccatcaaaaatatggtcttactaaagaaagagccactcaaatgaaa
ccaactactatcattatgcatccagctcctatcaatagaggagtggagatagatacggat
ttggtggaaagtcctcaatccagaatatttaagcaaatggagaatggtgtttacgcccga
atggcaatcctaaaacaggctttagaagacaaaggtattaagtttaaaacaatgtaa

DBGET integrated database retrieval system