KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_0749Help
Entry
RA0C_0749         CDS       T02107                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rai00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RA0C_0749
Enzymes [BR:rai01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     RA0C_0749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
724514..725338
Genome map
AA seq 274 aa AA seqDB search
MKTHSINCRGRLVDFSTPKIMGILNLTPDSFSDGGKFNTETSALIQTEKMLKEGASFIDL
GAQSTRPNAQLVSAQEEIKRIGNLISLIKKEFPEALISLDTFYSEVMRFGYEAGIDLIND
ISGGQFDPKVWETVAQLKLPYVLMHINPEYQAMHEKIAYDDITKSINFYFSEKINQLKAL
GIHDVILDPGFGFGKTIEDQMTMIDEVEHIGFGKYPLLIGISRKSFIYKPLGKSPLEIDE
ETQQLHLKVLQQGASILRVHDVASAKRTLDQYLS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcattctatcaactgcaggggaagacttgtagatttttctactccaaaaatt
atgggaatccttaaccttaccccagattctttttctgatggcggaaaatttaatacagaa
acttccgctttaattcaaactgaaaaaatgcttaaagaaggggcttcgtttattgattta
ggggctcaatctacacgccctaatgcccaattagtttcagcacaagaagaaattaaacgt
ataggaaacctcatcagtcttataaaaaaagaattccctgaggcactcatttctttagat
accttttatagtgaggtaatgcgttttggttacgaggcaggtatagacctcatcaatgat
atttctggtggacagtttgatcccaaagtatgggagaccgtagcccagctaaaactccct
tatgtactgatgcacattaacccagaatatcaagctatgcacgagaaaatagcctacgat
gatattactaaaagtatcaatttctatttttccgaaaaaataaatcagttgaaagcacta
ggcattcacgatgtgatattagaccctggatttgggttcggtaaaaccatagaagaccaa
atgacaatgatagacgaggtagaacacatcggatttggaaaatatcccctactgattggc
atttctagaaaatcatttatctataaacctttgggcaaatcgcccttggaaatagacgaa
gaaacgcaacaactacatttaaaagtgctccaacaaggtgctagtattctgcgagtacac
gatgttgcttcggctaaaagaacgctagaccaatacttatcataa

DBGET integrated database retrieval system