KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_0807Help
Entry
RA0C_0807         CDS       T02107                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rai00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(779346..779795)
Genome map
AA seq 149 aa AA seqDB search
MSQRKVILLLGSNIKNPKKNIEEAILLINKHLGNVIKKSKMLETEPVEFVSSNNFCNIAL
SLETDFSPIQILKKAKEIERYMGRVLDSRDLGGYEDRVIDVDIVAIGNLSYQSKMLNLPH
HRHLFVRNFSRKILEDLGENIEKYKNIQI
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaagaaaggttattttgttactaggaagcaatataaaaaatcctaaaaaaaat
atagaagaagctattttattgataaacaagcatctaggaaatgtgataaaaaagagtaaa
atgctagaaacagagcctgtggagtttgttagttctaataatttttgtaatattgcactc
tcgttggagactgatttttcgcctattcaaattttgaagaaagcaaaagaaatagaaagg
tatatgggaagggttcttgattctagggatttgggaggttatgaagatagagttatagat
gttgatatagttgccataggcaatctttcgtatcagtcaaaaatgttaaatttaccccat
cataggcatctttttgtgcgtaatttttctaggaaaattctagaagatttgggagagaat
attgaaaaatataaaaacattcaaatatga

DBGET integrated database retrieval system