KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_0828Help
Entry
RA0C_0828         CDS       T02107                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RA0C_0828
   01230 Biosynthesis of amino acids
    RA0C_0828
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RA0C_0828
   00030 Pentose phosphate pathway
    RA0C_0828
   00051 Fructose and mannose metabolism
    RA0C_0828
   00052 Galactose metabolism
    RA0C_0828
  Energy metabolism
   00680 Methane metabolism
    RA0C_0828
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    RA0C_0828
Enzymes [BR:rai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RA0C_0828
Protein phosphatases and associated proteins [BR:rai01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     RA0C_0828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(800381..801367)
Genome map
AA seq 328 aa AA seqDB search
MSESKLKRIGVLTSGGDSPGMNAAIRAVVRTAHYYGIECMGIREGYNGLIEGNMIKMGPR
SVKNIINQGGTILKSARSKEFRTVEGRLKAFEQCQKNEIGALVCIGGDGTFTGAKVFSEE
YGIKVVGVPGTIDNDIFGTDFTIGYDTALNTAVEAIDKIRDTATSHNRVFFVEVMGRDAG
FIALNSGIASGAIDILIPERKDSLEEMFENFHNAQKRGKTSSIVVVAEGEQLASTYELAE
KTQKEFPDYDIRVAILGHIQRGGMPSCADRVLASRLGYGAVEGLRKGLTNVMAGIRANQL
VFTPIEDAIKKHNEINQDLLKISEILAM
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaatcaaagttgaaaaggataggggttcttacttctggaggggattctccaggt
atgaatgcggcgataagggcagtggtaagaacagctcattattatggtatagaatgtatg
gggattagagaagggtacaatgggcttatagaagggaacatgattaaaatgggacctaga
tctgttaagaatattattaaccaaggtggtacaattctaaaatcagcaaggtctaaagag
tttagaacagtagaggggagattaaaggcttttgaacaatgccaaaagaatgaaatagga
gctttggtttgtattggtggagatggtacttttacaggagcaaaagttttcagcgaagag
tatggtatcaaggtggtgggtgtacctggaactattgataatgatatcttcggtactgat
tttacgataggatatgacacagctcttaacaccgcggtggaagctatagacaaaataaga
gatacggcaacctctcataacagagtgttttttgtggaagtgatggggagagatgcaggt
tttatagcacttaatagcggtattgcttcaggagctatagatattttgataccagagaga
aaggatagtctagaggaaatgtttgagaatttccataatgctcaaaaacgaggtaaaaca
tcgtctattgtagtagtagcagagggggagcagttggcttctacctatgagttagccgag
aaaactcaaaaagaattccctgattatgatatcagagtggctattctagggcatatccaa
agaggcggaatgcctagctgtgctgatagagtattggcgagtagattaggttatggagca
gtagaagggcttagaaaaggtcttactaatgtgatggcaggtataagagccaatcagcta
gtttttactccaatagaagatgctattaaaaagcacaacgaaatcaatcaagatttactg
aagatatcagaaattttggcgatgtaa

DBGET integrated database retrieval system