KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_0914Help
Entry
RA0C_0914         CDS       T02107                                 

Definition
peroxiredoxin
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rai00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    RA0C_0914
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RA0C_0914
Enzymes [BR:rai01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RA0C_0914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(891225..891791)
Genome map
AA seq 188 aa AA seqDB search
MKKLFIFILSALALVQCSSKKREVQQDTSKLSKSIYDYKVESLDGGEINFADFKGKKILI
VNTASECGFTPQYEALEKLYQKYKDRLVVVGFPANNFGGQEPGTNTEIKTFCQVNYGVTF
PMAAKVSVKGEDIAPIFQFLTKKELNGVKDTTILWNFTKFLLDENGKIIESYLSTTKPDS
EAITKHLK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactctttatattcatactttccgcactcgctttagtgcaatgttctagtaaa
aaaagagaggttcaacaggatacatctaagctttctaaaagtatctacgattataaagtg
gaaagtttagacggtggagaaattaattttgcggatttcaaaggcaaaaaaatacttatt
gtaaatacagcgtctgagtgtggttttacacctcagtatgaagccttggaaaagctctat
caaaaatataaagataggctagtggtagtaggcttccctgctaataactttggaggacaa
gagccaggaactaataccgagattaaaactttttgtcaagtgaactatggagtaactttt
cctatggcagctaaggtttctgtgaaaggagaagatatagcacctatttttcagtttctt
actaaaaaggaattaaacggagttaaagataccaccatactttggaattttaccaaattt
cttctagacgaaaacggaaaaataatagaaagctatctaagtactactaagcctgatagc
gaagcgattacaaaacatttaaaataa

DBGET integrated database retrieval system