KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_0914Help
Entry
RA0C_0914         CDS       T02107                                 

Definition
(GenBank) peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
rai00480  Glutathione metabolism
rai00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rai00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    RA0C_0914
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RA0C_0914
Enzymes [BR:rai01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     RA0C_0914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin RuvX
Motif
Other DBs
NCBI-ProteinID: AFD55852
UniProt: E4TBL2
Position
complement(891225..891791)
Genome map
AA seq 188 aa AA seqDB search
MKKLFIFILSALALVQCSSKKREVQQDTSKLSKSIYDYKVESLDGGEINFADFKGKKILI
VNTASECGFTPQYEALEKLYQKYKDRLVVVGFPANNFGGQEPGTNTEIKTFCQVNYGVTF
PMAAKVSVKGEDIAPIFQFLTKKELNGVKDTTILWNFTKFLLDENGKIIESYLSTTKPDS
EAITKHLK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactctttatattcatactttccgcactcgctttagtgcaatgttctagtaaa
aaaagagaggttcaacaggatacatctaagctttctaaaagtatctacgattataaagtg
gaaagtttagacggtggagaaattaattttgcggatttcaaaggcaaaaaaatacttatt
gtaaatacagcgtctgagtgtggttttacacctcagtatgaagccttggaaaagctctat
caaaaatataaagataggctagtggtagtaggcttccctgctaataactttggaggacaa
gagccaggaactaataccgagattaaaactttttgtcaagtgaactatggagtaactttt
cctatggcagctaaggtttctgtgaaaggagaagatatagcacctatttttcagtttctt
actaaaaaggaattaaacggagttaaagataccaccatactttggaattttaccaaattt
cttctagacgaaaacggaaaaataatagaaagctatctaagtactactaagcctgatagc
gaagcgattacaaaacatttaaaataa

DBGET integrated database retrieval system