KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_0938Help
Entry
RA0C_0938         CDS       T02107                                 

Definition
(GenBank) cytochrome-c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Brite
Enzymes [BR:rai01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     RA0C_0938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C DUF1924 Cytochrome_CBB3 Cytochrom_C1 Cytochrom_C550 CAP18_C Haem_bd
Motif
Other DBs
NCBI-ProteinID: AFD55874
UniProt: E4TBN6
Position
complement(917754..918800)
Genome map
AA seq 348 aa AA seqDB search
MKSYIITGLVVLVSVLSCRSDEAEVQYPIDQPYAFGIPSNFPEVKYNLQANKPTEYGVQL
GKKLFYDGRLAKDNAVACAFCHIQEDAFTHHGHTVSHGVEGREGFRNALPIQNMIFLDKY
MWDGSVTDLEMQPIIPISAHEEMDETIENITQKIKDDKDYKRLFTIVYGDDKVTAERILK
SLTQFMSIMISANSKYDKVVRNEGEKFTEEEARGYTIFKQKCTACHSTDLFTDQSYRNTG
LPYNPILKDEGRKRVTGKDSDFLKFRVPSLRNVEYTAPYTHDGRFYTLKALLDFYDSGVI
DNPNLDPEFRKVKGRVGIPLTEQEKYDLISFLKTLSDTQFITNPAFSE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagctatattatcacagggctggtggttcttgtttctgtgctttcttgtcggagc
gatgaggcggaagttcagtatcctatagaccaaccttacgcatttggaataccatctaat
tttccagaagtgaagtacaatttacaggctaataaacctacggaatatggcgttcagtta
gggaaaaagctattttatgacggaagattagccaaagataatgctgtagcgtgtgctttt
tgccatattcaagaagatgcctttacacatcatgggcatacggtaagccacggagtagaa
ggtagagagggttttaggaacgctttgccaattcaaaatatgatttttttggataaatat
atgtgggacggttctgtaaccgatttagagatgcaacccattattcctatttcggcacac
gaagaaatggacgaaaccatagaaaatattacacaaaagattaaagacgataaagattat
aaaagactttttaccattgtgtatggcgatgacaaagttacggctgaaagaattttgaaa
tctctcacacagtttatgtctataatgatttcggctaacagtaagtacgataaagtggta
aggaatgaaggagaaaaatttacagaggaggaggcgagaggttatactatttttaagcaa
aaatgtacggcatgtcattccacggatttgtttacagaccaaagctacagaaatacaggg
ctgccttataatccgatattaaaagatgaaggtagaaaaagagtaacaggtaaagattct
gattttttgaagtttagagttcctagccttagaaatgtggaatataccgctccttatact
cacgatggtagattttataccttaaaggcattgcttgatttttacgattcgggagttata
gataatcctaacttagaccctgaatttagaaaggttaaaggtagagtaggaattccttta
acagagcaagaaaaatatgaccttatttcatttttaaaaactttaagtgatactcaattt
attactaacccagcattttcagaatag

DBGET integrated database retrieval system