KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_0938Help
Entry
RA0C_0938         CDS       T02107                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(917754..918800)
Genome map
AA seq 348 aa AA seqDB search
MKSYIITGLVVLVSVLSCRSDEAEVQYPIDQPYAFGIPSNFPEVKYNLQANKPTEYGVQL
GKKLFYDGRLAKDNAVACAFCHIQEDAFTHHGHTVSHGVEGREGFRNALPIQNMIFLDKY
MWDGSVTDLEMQPIIPISAHEEMDETIENITQKIKDDKDYKRLFTIVYGDDKVTAERILK
SLTQFMSIMISANSKYDKVVRNEGEKFTEEEARGYTIFKQKCTACHSTDLFTDQSYRNTG
LPYNPILKDEGRKRVTGKDSDFLKFRVPSLRNVEYTAPYTHDGRFYTLKALLDFYDSGVI
DNPNLDPEFRKVKGRVGIPLTEQEKYDLISFLKTLSDTQFITNPAFSE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagctatattatcacagggctggtggttcttgtttctgtgctttcttgtcggagc
gatgaggcggaagttcagtatcctatagaccaaccttacgcatttggaataccatctaat
tttccagaagtgaagtacaatttacaggctaataaacctacggaatatggcgttcagtta
gggaaaaagctattttatgacggaagattagccaaagataatgctgtagcgtgtgctttt
tgccatattcaagaagatgcctttacacatcatgggcatacggtaagccacggagtagaa
ggtagagagggttttaggaacgctttgccaattcaaaatatgatttttttggataaatat
atgtgggacggttctgtaaccgatttagagatgcaacccattattcctatttcggcacac
gaagaaatggacgaaaccatagaaaatattacacaaaagattaaagacgataaagattat
aaaagactttttaccattgtgtatggcgatgacaaagttacggctgaaagaattttgaaa
tctctcacacagtttatgtctataatgatttcggctaacagtaagtacgataaagtggta
aggaatgaaggagaaaaatttacagaggaggaggcgagaggttatactatttttaagcaa
aaatgtacggcatgtcattccacggatttgtttacagaccaaagctacagaaatacaggg
ctgccttataatccgatattaaaagatgaaggtagaaaaagagtaacaggtaaagattct
gattttttgaagtttagagttcctagccttagaaatgtggaatataccgctccttatact
cacgatggtagattttataccttaaaggcattgcttgatttttacgattcgggagttata
gataatcctaacttagaccctgaatttagaaaggttaaaggtagagtaggaattccttta
acagagcaagaaaaatatgaccttatttcatttttaaaaactttaagtgatactcaattt
attactaacccagcattttcagaatag

DBGET integrated database retrieval system