KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_0970Help
Entry
RA0C_0970         CDS       T02107                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rai00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:rai00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
950217..950738
Genome map
AA seq 173 aa AA seqDB search
MLNLSKNSIKMTTIIVAMGKNNEIGFNNQLLWHLPKDLKHFKNLTSGHPIIMGRKTYESI
GKPLPNRTNIVVSQKKDWFEEGILIVGTLKEAIKFAKKIDENIFIIGGGSIYEQTIDQAD
RLEVTLVDTTLKADTFFPKINPKEWLKTDEICHEKDEQNPYNFCFQTYERVQK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgctaaatttgtcaaaaaatagtataaaaatgaccaccatcattgtagcaatgggtaaa
aataatgaaataggctttaataaccaacttctttggcatttacctaaagatttgaaacac
ttcaaaaatttaacctcagggcaccctataattatggggcgaaaaacctatgaaagcatt
ggaaaacctctacccaacagaactaatatcgtggttagtcaaaaaaaagattggtttgag
gaaggtattctgattgttggtactttaaaggaagctattaaatttgccaagaaaatagac
gaaaatattttcatcatcggtggtggcagcatttatgaacagaccatagaccaagcagac
cgactggaagtaactttagtggataccactctaaaggcagatacctttttcccaaaaatc
aacccaaaagaatggctaaaaactgatgaaatttgccatgaaaaggacgagcaaaaccct
tataatttttgctttcaaacttatgaaagagtacagaaataa

DBGET integrated database retrieval system