KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_0974Help
Entry
RA0C_0974         CDS       T02107                                 

Definition
dtdp-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rai00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    RA0C_0974
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RA0C_0974
Enzymes [BR:rai01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     RA0C_0974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(954113..954658)
Genome map
AA seq 181 aa AA seqDB search
MKIKETPLKDCYIIEPTIFEDERGYFYEKFNEKKFEDLTGMNGHFVQDNISKSSYGVLRG
LHLQKGEHAQAKLVSCLEGKVWDVAVDLREDSPSFGKWYGVELTAENKLQFYVPRGFAHG
FAVLSEMAVFAYKCDNFYNKESEGGILWNDADLAIDWKLDETDVILSEKDKVQLPFSKKN
F
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaagattaaagaaacgccactaaaggattgttacatcatagagcctactatttttgaa
gacgaaagaggttacttttacgagaagtttaacgagaaaaaatttgaggaccttacggga
atgaatgggcattttgttcaagataatatttctaaatcgtcttatggggttcttagaggg
ttgcacctacagaaaggagagcatgcccaagcgaaactcgtatcttgcttagaggggaag
gtttgggatgtggcggtggatttaagagaagattcgccttcgtttgggaaatggtatgga
gtggaattaacggcagaaaataagttacagttttatgtgccgagaggctttgctcacggc
tttgcggtgttgagtgaaatggcagtttttgcctataaatgtgataatttttacaataag
gagtctgaaggcggaatcctttggaacgatgcggatttagctatagattggaagttggat
gagacagatgttattctttccgaaaaagataaagtacagttgccattttctaaaaagaat
ttttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system