KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_0986Help
Entry
RA0C_0986         CDS       T02107                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
rai00250  Alanine, aspartate and glutamate metabolism
rai01100  Metabolic pathways
rai01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rai00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RA0C_0986
Enzymes [BR:rai01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     RA0C_0986
Peptidases [BR:rai01002]
 Cysteine Peptidases
  Family C44
   RA0C_0986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 QueC DUF1933 NAD_synthase Sec23_trunk Arginosuc_synth
Motif
Other DBs
NCBI-ProteinID: AFD55919
UniProt: E4TA16
Position
complement(963300..965189)
Genome map
AA seq 629 aa AA seqDB search
MCGINGLILKDINSDSAIKKLEIMNQRIFHRGPDEDGFFVEQKEQNVIGFAMRRLSIIDL
SSGKQPIFSEDGTKVIVFNGEIYNYQSLRKQLLSVGKTFKTNSDTEVILRLYEVYGKEAF
KMLDGMFAFSIYDKSINKVFIARDFFGEKPLYYQNSKGGLIWCSELKSLMSVSEEERVIS
KEGLNLYFQLTYIPAPFTIYEGVYKLEPNHFIEYDLVANEFRLEKIHIEGKFDKREISFD
DAKKELRDLVKESVLSRSISDVPIGTFLSGGVDSSIVTVCLAEEMGQKINTFSIGYDKKS
FDESDKSKIVAKQIGSTHHQFILKEQDLEDEITSVLQNFDEPFADSSALPSFFVAKKTSE
YVKVALTGDGGDEVFGGYNKYLIGKINERYTQIVPKALHCTIKKVSDFLTKQKEDQRGLK
FKVRKAVNAIDYGGEFYYNMVKLGFQEPELSRFLRKEWLVKDALSLYKERIPNPKTLNDF
RNVDRMISLEGDMIVKVDRTSMLTSLECRAPFLNKKLWDYSHTLPEHYLLNGNNKKYILK
KAFEDKFPEGFLEKSKKGFGVPVGDWLKSTLKEELMSYVVTEKLEKQGLFNVLEIQKLVY
NHLNEIEDNTFRVWTLYCFQKWYFNMHLE
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtattaatggacttattttaaaagatataaattctgattcagcgataaagaag
ctggaaataatgaatcaaagaatttttcatcgtggaccagatgaagatgggttctttgta
gagcaaaaagagcaaaatgttatagggtttgctatgcgtaggctttctattattgacttg
tctagtggtaagcaacctattttttcagaggatggaactaaggttatcgtttttaatggt
gaaatttataattatcaaagtttaagaaagcagcttttatccgtaggaaaaacctttaaa
accaattctgacaccgaagttatactaaggttatatgaagtttatgggaaagaggcattc
aaaatgttagacggaatgtttgctttctctatttatgataagtctattaataaagtattt
atagcaagggacttctttggggagaaacccctatattatcagaattcaaagggaggactt
atttggtgttcggagttaaaatctttaatgtcggtttcagaagaagaacgagttatttct
aaagaaggattaaatctttactttcagttgacttatatacccgcaccttttacaatttat
gagggagtctataagttagaacccaatcactttatagagtatgatttggttgcgaatgaa
tttagattagaaaaaatacatattgaaggtaaatttgataagagagagatttcatttgat
gatgctaagaaggaattgagggatttggtaaaggaaagtgttctttctagaagtatttct
gatgttcccataggtacttttttgtctggtggagtagattcttctattgtaacggtttgt
ttagctgaagaaatggggcaaaagattaatactttttctattggctatgataaaaaatcg
tttgacgagtcggataaatcaaaaattgtagctaagcagataggctctacacatcatcaa
tttatacttaaagaacaagatttagaagacgaaataacttctgtactacagaattttgac
gagccgtttgctgactcttctgcattgcctagtttttttgtggcaaaaaaaactagtgaa
tatgtaaaagtagctctgacaggagatggaggagatgaagtctttggaggatataacaaa
tatcttataggaaaaataaatgaaagatatacgcaaatagtgccaaaggctttgcattgt
acgataaaaaaagtgtcagactttttaactaaacaaaaagaggatcagcggggattgaaa
tttaaagtgcgaaaagcagttaatgccattgactacgggggagagttttactataatatg
gttaagttaggttttcaagagcctgaactatcacgttttcttaggaaagaatggttagta
aaagatgctttgagtctttacaaagagagaatacctaatcctaaaacacttaacgatttt
cgtaatgtggatagaatgataagtttggaaggagatatgattgtaaaagtggatcggaca
agtatgttgacttcgttggaatgtagggcgccctttttaaataaaaaactttgggattat
tctcacactcttccagagcattatttgcttaatgggaataataaaaagtatatactaaag
aaggcttttgaggataaatttccagaaggttttttagagaaatcaaagaaaggttttgga
gtacctgttggggattggttaaaatctacacttaaagaggaattaatgtcttacgtagta
acagaaaaattggagaaacaaggtctttttaatgttctagaaatccaaaaattggtttac
aatcatttaaatgaaatagaagataatacattccgtgtttggacgctttactgctttcag
aagtggtattttaatatgcatttagagtaa

DBGET integrated database retrieval system