KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_1080Help
Entry
RA0C_1080         CDS       T02107                                 

Definition
holliday junction DNA helicase subunit ruva
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rai00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    RA0C_1080
Enzymes [BR:rai01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RA0C_1080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1073310..1073894
Genome map
AA seq 194 aa AA seqDB search
MIYSLRGIVQELSPTHLIIETGGVGYFVSVSVNTSKHFSIGKESLIYTQQIIREDAHLLY
GFSELKEKEMFNLLISVNGVGPASAMIMLSSLELREIAQAILSSNSAVLQKVKGIGTKTA
QRIIIDLKDKVLHFGADESDISTVIDNKVKEESLSALEVLGIPKKMSEKLANKILKQNPE
IQTEDLVKQILKNI
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatttactctctacgaggtatcgttcaggagcttagcccaacccatttaattatagaa
actggtggtgtaggctactttgtaagcgttagtgtaaacacttctaaacacttttccatt
gggaaagaatctttaatctacacacaacaaatcattcgagaagacgctcacttattgtac
ggtttttcggagctcaaagagaaagaaatgtttaacctacttatttctgtaaatggtgta
ggaccagcctctgctatgattatgctttcctcactagaattaagagaaatagcacaagcc
atactctctagcaatagtgctgtattacaaaaagtaaaaggtataggcaccaaaactgca
caacgaattatcattgatttaaaagataaagtattgcattttggagcagatgaatctgat
atttccaccgttattgataataaagtaaaagaagaatcgttatctgcattagaagtttta
ggaatccctaaaaaaatgtcagaaaagttagccaacaaaattttgaaacaaaatccagaa
attcaaacggaagatttagtaaaacaaattttgaaaaacatttaa

DBGET integrated database retrieval system