KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_1275Help
Entry
RA0C_1275         CDS       T02107                                 

Definition
alkaline phosphatase d
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rai00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation
Environmental Information Processing; Signal transduction; Two-component system [PATH:rai02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1261119..1262138
Genome map
AA seq 339 aa AA seqDB search
MTLLKKLLSISIFSGLLIANAQEKFTIGIASCSKQDKDLSLLDKVVEKKPNLFIWMGDNI
YGDTYDMKVLEAKYQKLTNNPHFKNLKKNVPMLSTWDDHDYGWNDAGKEYPHKEASKALF
LKYWEVNNKFRQTNPNGIYGVEYFTFKNKKIQIIILDTRFNRDALCKFESTMPFGKNDYV
PCRDTSKSFLGEAQWNWLEEILKTPADLRILVSSIQFSHEYNGWESWTNLPSQQQKMMDL
IKKTKAENLFVISGDVHWGELSKYSLPNQYPIYDLTSSGLTEKWPSLEPNKFRIGEAVVE
PNYGIIEYDGENQITFKLYDHKDILKLNYQLDLETLKFK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacattactaaaaaaattactttcaatatctatattttctggactactcattgctaat
gctcaagagaaatttaccataggaatagcctcttgttctaaacaagataaagacttatca
ctattagataaagtggttgaaaagaaacccaacttatttatatggatgggagataacatc
tatggagacacctacgatatgaaggttctagaagctaagtatcaaaaattaaccaacaat
cctcattttaaaaacctaaagaaaaatgttccgatgctatctacttgggacgaccacgac
tatggctggaatgatgcggggaaagaataccctcacaaagaagcttctaaagccttgttt
ttaaaatattgggaggttaataataaattcagacagactaaccctaacggtatttatgga
gtagaatatttcacttttaaaaacaaaaaaattcaaatcattattttagacactagattt
aatcgtgatgctctttgtaaatttgaaagtacaatgcctttcggaaagaacgactatgtt
ccgtgccgagatacttctaaaagttttctaggagaagctcaatggaactggctagaggaa
attctaaaaactcctgcagatttaaggattttggtttctagtatccagttctcacacgaa
tacaatggttgggaatcttggacaaaccttcctagccaacaacaaaaaatgatggattta
attaaaaaaactaaagccgaaaatctttttgtaatatctggagatgtacattggggagag
ttatcaaagtacagcctacccaaccaatatcctatctatgatttaacgtctagtggatta
accgaaaaatggccgtccctagagcctaataaatttagaataggagaagctgttgtagaa
cccaactacggaataatagagtacgatggagagaaccaaatcacatttaaactctatgac
cacaaagatattctaaagctaaattatcaactagatttagagactttaaaatttaaataa

DBGET integrated database retrieval system