KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_1416Help
Entry
RA0C_1416         CDS       T02107                                 

Definition
udp-n-acetylglucosamine1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rai00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:rai00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1422461..1423768
Genome map
AA seq 435 aa AA seqDB search
MSGAFQIRGGKRLQGEITPQGAKNEALQILCAVLLTDQEVRIKNIPDIQDVNKLIGILGD
LGVKVTKNGKGDYIFKADSLNLDYLKSEEFKKEGAKLRGSIMLLGPMLARFGEGYMPTPG
GDKIGRRRLDTHFQGFVELGAEFHFNDVESFYSLKAKSLQGKFILLEEASVTGTANIIMA
AVLAKGKTRIYNAACEPYLQQLCKMLNRMGAQISGIGSNLLTIEGVSYLHGTEHTMLPDM
VEIGSWIGLAAMTKSEITIKDVHWNQLGIIPNTFRKLGIQLEKSGEDIYIPAQEHYKIQK
FIDGSILTISDAPWPGFTPDLLSIMLVVATQAKGSVLIHQKMFESRLFFVDKLIDMGAQI
ILCDPHRATVIGLNQETPLRGTVMTSPDIRAGNALLVAALSAEGKSIIHNIEQIDRGYEN
IDGRLKALGADIERI
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtgcttttcaaatcagaggcggtaaaagacttcaaggcgaaattacgccccaa
ggagctaaaaatgaagctctacaaatattatgtgctgttttattaacagatcaagaagta
agaataaaaaatatacctgatatacaagatgttaataagctaattggtatactgggagac
ctaggtgttaaggtaaccaaaaatggaaaaggggactatatcttcaaggctgatagtctt
aatttagattatcttaaatccgaagaatttaaaaaagaaggagctaaacttagaggttct
attatgcttttaggtcctatgttggctaggtttggcgaaggttatatgccaactccagga
ggagacaagataggaagaagaaggttagatactcattttcagggatttgttgagcttggt
gcagagtttcattttaatgatgtagaaagtttttatagtctaaaagcaaagtctttacaa
ggtaaatttatccttttagaagaagcatcagtaacaggtacggctaatattattatggcg
gctgtattagcgaaaggtaaaactagaatttacaatgctgcttgtgagccttatttacaa
cagctttgtaaaatgcttaaccgaatgggagctcaaatttcgggtatcggctcaaattta
ttaaccatagaaggtgtttcatatttacatggtacagaacacactatgttgccggatatg
gtagaaataggctcttggatagggttggcagcaatgacgaagtctgaaatcaccattaaa
gatgttcactggaatcagttggggattattccaaatacttttagaaaattgggtattcag
ctagagaaaagcggtgaagatatttatatcccagcacaagaacactacaaaatacagaaa
tttatagatggctctattttaaccatttctgatgcaccttggccaggtttcacgccagat
ttgctgtctattatgttggtagtagcaactcaagctaaaggaagtgtattgatacatcaa
aaaatgtttgaatctcgattgttctttgtggataaactgatagatatgggagctcagatt
atcctttgtgacccacaccgagctacggttattggtcttaatcaagaaacgccacttaga
ggtactgtgatgacttcccctgatattcgtgcaggaaatgcacttttggtagctgcactt
tcggctgaaggtaaatctatcattcataatatagagcagatagaccgaggttacgaaaat
atagatggcaggctcaaggctttaggagcagatatagagcgtatataa

DBGET integrated database retrieval system