KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_1477Help
Entry
RA0C_1477         CDS       T02107                                 

Definition
uroporphyrinogen-iii synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rai00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RA0C_1477
Enzymes [BR:rai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     RA0C_1477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1484062..1484805
Genome map
AA seq 247 aa AA seqDB search
MSKIKSILISQPQPAESSPYLELAKKEKIEIDFRPFIYVQGADAKDLRTQKIDLSKYTGI
IFTSRNAIDHYFRLAEEMRFSVPDSMRYICQSEAIANYLQKHIVYRKRKISFGEKLPTDI
IPLLKKYPSEKYLLPSSDILNDGITKVLDESGVDWTRAIMYRTVNSDLSDININGYDVLV
FFSPQGIKSLVENFKDYKKSKFKVAVFGNSTKAEAEKAGLTVDIVAPTKENPSMTMALEN
FIKKANK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaattaaatctattctaatatctcagcctcaacctgcggaatcatctccttat
ttagaacttgcgaaaaaggaaaaaatagaaatagattttcgtccatttatttatgttcag
ggggcggatgctaaggatttgagaacacaaaaaatagacctttctaagtatacaggaatt
atttttactagtagaaacgcaatagatcactactttcgtttagctgaggagatgcgtttt
tcggtgccagattctatgcgatacatttgccagtcagaggctatcgccaattatttgcaa
aagcacattgtttacagaaaaagaaaaattagttttggtgaaaaattacccactgatata
atccctttgcttaagaaatatccatcagagaagtatcttttaccctcttctgatattctt
aatgatgggataaccaaagttttagacgagtctggagtagattggactagggctattatg
tatcgtaccgttaatagcgatttgtctgatataaatatcaatggctatgatgttctagtg
ttttttagcccacaagggataaagtctttggtagaaaactttaaagattataaaaaatct
aaatttaaagtagctgtttttggtaattctactaaagcagaagcggaaaaagctgggcta
acagtagatattgtggcgcctaccaaagaaaatccgtctatgacaatggcattagaaaac
ttcatcaaaaaagccaataagtag

DBGET integrated database retrieval system