KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_1641Help
Entry
RA0C_1641         CDS       T02107                                 

Definition
uroporphyrinogen iii synthase hem4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rai00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1656594..1657253)
Genome map
AA seq 219 aa AA seqDB search
MASSILLTKEINPEKRQLLLNEGLEVDTKDFIRIKFINTEKISLRNKTLIFTSANGVEGF
FKNGFDAPHSSVICVGGKTESKLAEKGIKTLHTAKNAEELASFILQQQWDNPDFVHFCGN
LALDTLEKSIANHNANYIKKIVYETELLYPTLNKKYDALVFFSPSGVRSFVKNNSITDEM
VFCIGNTTALEVAKYTSQKPIISTKQNLNDLLSLVKSVV
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggctagttctattctcttgactaaggaaatcaatcctgaaaaacgccaactcctgtta
aacgaaggactagaggttgataccaaagattttattagaattaaattcatcaataccgaa
aagattagtctgcgtaataaaacacttatattcactagtgcaaatggggtagaaggcttt
tttaaaaacggttttgatgcacctcattcatctgtgatttgtgtaggtggcaaaactgaa
agcaaacttgcagaaaaaggcatcaaaactctacatacggctaagaatgccgaagaatta
gcctcgtttatacttcaacagcaatgggataatcctgattttgttcacttttgtggcaac
cttgcattggatactttagaaaaaagcatcgctaatcacaatgcgaattatataaagaaa
atagtttacgaaaccgaacttctataccctactcttaacaaaaaatatgatgctttagtt
ttttttagtccaagtggagttcgtagctttgtaaaaaataattctataaccgatgaaatg
gtcttttgtataggaaatactaccgctttggaagtggcaaaatacacctcacagaaacct
ataattagcaccaagcaaaacctcaacgatttgcttagtctagtaaaatcggtagtctaa

DBGET integrated database retrieval system