KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_1843Help
Entry
RA0C_1843         CDS       T02107                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RA0C_1843
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RA0C_1843
   00052 Galactose metabolism
    RA0C_1843
   00500 Starch and sucrose metabolism
    RA0C_1843
   00520 Amino sugar and nucleotide sugar metabolism
    RA0C_1843
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RA0C_1843
   00524 Butirosin and neomycin biosynthesis
    RA0C_1843
Enzymes [BR:rai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RA0C_1843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1860883..1861932)
Genome map
AA seq 349 aa AA seqDB search
MPFQNKFPLHLPGEKSTENQNISLVATDVKQKDTTLGYYVSENGKLELKAKKEYNTQDFG
LFSDILNLFLEEYGLSKPSRISIAVPGPVLNGKCTTENLPFDLDIELIRSRTEVEHITLI
NDLEAMAYGLKGTEDKDFCTLHKNSSTTKGNVAILAPGRGLGEAGMFWDGECLRPFATEG
GHSEFSPRAEDELELYRFLKAIHGIVSWESVLSHEGLFNVYRFVRDMRRQEEPEWLTQKL
EKGDCHEVIIDAALNGENRACALTVEAYVDFIAREASNLVLKLKATGGLILAGSLAVKIE
ALLKMPSFYQTFVISDKMENILKSTPIYLLKNENAILTGAAYYGAFGKH
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgccttttcaaaataaattcccgctccatttacctggagaaaaatcaactgaaaaccaa
aacataagcctcgttgcgaccgatgtaaaacagaaggacactaccttaggctactatgtt
tctgagaacggaaaattagaattaaaagctaaaaaagagtacaatacccaagattttggg
ctttttagtgatattctaaaccttttcttagaagagtatggtttaagcaaaccctctaga
atttctatagcagtaccaggtcctgttttaaatggcaaatgcactaccgaaaaccttcct
tttgatttagatatagaactcattagaagtagaaccgaagtagaacacattacgcttatc
aacgacttagaagcaatggcctacggacttaaaggtacggaagataaagacttctgcacc
ctacacaagaacagcagcactactaaaggtaatgtagctattttagctcctgggagaggt
ttaggcgaagcaggtatgttctgggacggagaatgtttacgcccttttgcaaccgaaggt
gggcactccgaattttctcctagagcagaagacgaactagagctttatcgttttttaaag
gcgatacacggcatcgtaagttgggagtcagtgttatctcatgagggattattcaatgtg
tatcgttttgtaagagatatgagacgacaagaagaaccagaatggcttacacaaaaacta
gagaaaggggactgccacgaagtcatcatagatgcggcactcaatggcgaaaacagagct
tgtgctttaaccgtagaggcgtatgttgatttcattgctagagaagcgagtaacctcgtt
ctaaaactaaaagcaacaggagggcttattttagcaggaagccttgcggtaaagatagaa
gcactactcaaaatgccaagtttctaccaaacttttgtgattagcgacaaaatggaaaac
atcttaaaaagtacccctatctatcttctaaagaatgagaacgccattcttacaggagcg
gcttactacggtgcttttggaaaacactag

DBGET integrated database retrieval system