KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_1863Help
Entry
RA0C_1863         CDS       T02107                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RA0C_1863
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RA0C_1863
   00640 Propanoate metabolism
    RA0C_1863
   00660 C5-Branched dibasic acid metabolism
    RA0C_1863
Enzymes [BR:rai01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RA0C_1863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1888451..1889641
Genome map
AA seq 396 aa AA seqDB search
MNLHEYQSKEILAKYGVRVQRGIVASTVEEAKKAAEQLSAETGTKAWVVKAQVHAGGRGK
GGGVKFSPNMEKLEENARNIIGMQLVTPQTSAEGKKVHSVLIAEDMYYPGDSEPKEYYVS
VLLDRAKGKNMIVYSTEGGMDIEQVAEETPHLIHNEEVDPALGLQPFQARKIAFNLGLEG
EAFKDFVKFITALYNAYVGIDASLFEINPVLKTSDNKIAAVDAKVTLDNNALFRHKDLAE
LRDKREEDPTEVEAGEAGLNFVKLDGNVGCMVNGAGLAMATMDIIKLSGGNPANFLDVGG
TADAERVEKAFGIILKDPNVKAILINIFGGIVRCDRVAQGVVDAYKSFGELPVPLIVRLQ
GTNAEEAKRLIDESGLPVHSAITLEEAANKVKEVLA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtatcaatcaaaagagattttagcgaaatacggcgttagagtacaa
agaggtatagtagctagcaccgtagaggaagcaaaaaaagcagcagaacagctttctgca
gaaacaggaactaaagcgtgggtagtaaaagctcaggtacacgcaggtggtagaggtaaa
ggtggaggtgttaagttttctcctaacatggaaaagttagaagaaaacgcaagaaacatc
atcggaatgcagttagtaacgcctcaaacttctgctgaaggtaaaaaagtacactctgta
cttattgcagaagatatgtattatcctggagattctgaaccaaaagaatactatgtttct
gtacttttagatagagctaaaggaaagaatatgattgtatattctacagaaggtggtatg
gatatagagcaagtggcagaagaaactccacaccttatccataacgaagaggtagatcct
gctttaggattacaacctttccaagctagaaagattgcatttaatctaggtctagaagga
gaagctttcaaggattttgtaaaattcattacagctctttataatgcttatgtaggtatt
gatgcttctttatttgaaatcaaccctgttcttaaaacttcagataacaaaatcgctgca
gtagatgctaaagtaactttagataataatgcacttttccgtcataaagatttagctgaa
ttaagagacaaaagagaggaagaccctacagaagttgaagctggtgaagctggattaaac
ttcgttaagctagacggtaacgtaggttgtatggtaaatggagctggtttagcaatggct
actatggatatcattaaactttctggaggtaaccctgctaacttcctagatgtaggtggt
actgcagatgctgaaagagtagaaaaggcatttggtattatccttaaagaccctaatgta
aaagcaattcttatcaacatctttggtggtattgtaagatgtgatagagtggcacaaggt
gtagtagatgcttacaagagcttcggagaacttccagtacctcttatcgtaagattacaa
ggaactaatgctgaagaagctaagagattaatcgacgaatctggactaccagtacattct
gcaattactctagaagaagcagcaaacaaagtaaaagaggtattagcttaa

DBGET integrated database retrieval system