KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_1863Help
Entry
RA0C_1863         CDS       T02107                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:rai01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rai00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:rai00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1888451..1889641
Genome map
AA seq 396 aa AA seqDB search
MNLHEYQSKEILAKYGVRVQRGIVASTVEEAKKAAEQLSAETGTKAWVVKAQVHAGGRGK
GGGVKFSPNMEKLEENARNIIGMQLVTPQTSAEGKKVHSVLIAEDMYYPGDSEPKEYYVS
VLLDRAKGKNMIVYSTEGGMDIEQVAEETPHLIHNEEVDPALGLQPFQARKIAFNLGLEG
EAFKDFVKFITALYNAYVGIDASLFEINPVLKTSDNKIAAVDAKVTLDNNALFRHKDLAE
LRDKREEDPTEVEAGEAGLNFVKLDGNVGCMVNGAGLAMATMDIIKLSGGNPANFLDVGG
TADAERVEKAFGIILKDPNVKAILINIFGGIVRCDRVAQGVVDAYKSFGELPVPLIVRLQ
GTNAEEAKRLIDESGLPVHSAITLEEAANKVKEVLA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtatcaatcaaaagagattttagcgaaatacggcgttagagtacaa
agaggtatagtagctagcaccgtagaggaagcaaaaaaagcagcagaacagctttctgca
gaaacaggaactaaagcgtgggtagtaaaagctcaggtacacgcaggtggtagaggtaaa
ggtggaggtgttaagttttctcctaacatggaaaagttagaagaaaacgcaagaaacatc
atcggaatgcagttagtaacgcctcaaacttctgctgaaggtaaaaaagtacactctgta
cttattgcagaagatatgtattatcctggagattctgaaccaaaagaatactatgtttct
gtacttttagatagagctaaaggaaagaatatgattgtatattctacagaaggtggtatg
gatatagagcaagtggcagaagaaactccacaccttatccataacgaagaggtagatcct
gctttaggattacaacctttccaagctagaaagattgcatttaatctaggtctagaagga
gaagctttcaaggattttgtaaaattcattacagctctttataatgcttatgtaggtatt
gatgcttctttatttgaaatcaaccctgttcttaaaacttcagataacaaaatcgctgca
gtagatgctaaagtaactttagataataatgcacttttccgtcataaagatttagctgaa
ttaagagacaaaagagaggaagaccctacagaagttgaagctggtgaagctggattaaac
ttcgttaagctagacggtaacgtaggttgtatggtaaatggagctggtttagcaatggct
actatggatatcattaaactttctggaggtaaccctgctaacttcctagatgtaggtggt
actgcagatgctgaaagagtagaaaaggcatttggtattatccttaaagaccctaatgta
aaagcaattcttatcaacatctttggtggtattgtaagatgtgatagagtggcacaaggt
gtagtagatgcttacaagagcttcggagaacttccagtacctcttatcgtaagattacaa
ggaactaatgctgaagaagctaagagattaatcgacgaatctggactaccagtacattct
gcaattactctagaagaagcagcaaacaaagtaaaagaggtattagcttaa

DBGET integrated database retrieval system