KEGG   Riemerella anatipestifer ATCC 11845 = DSM 15868: RA0C_1969Help
Entry
RA0C_1969         CDS       T02107                                 

Definition
nitrous oxide reductase apoprotein
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
rai  Riemerella anatipestifer ATCC 11845 = DSM 15868
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:rai00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2007109..2009115)
Genome map
AA seq 668 aa AA seqDB search
MKINKILGYSALFLGSIYALESCKPKGTENAVAGDAAEKVYVAPGKHDEFYNFVSGGFNR
QMGVYGLPSGRLLKVVPIFSVNPENGYGYSEETKPMLETSHGFIPWDDQHHLELSQTNGE
VDGRWIFANANNTPRIARVDLSSFKTVEVLELPNSAGNHSSPFITENTEYVVAGTRFSVP
TDDANGDVPINSFKENFKGVISFVKVDKTTGEMKLAFQIEAPGVNFDLSHAGKGKSHGWF
FFSCYNSEQANSLLEVNASQFDKDFIMALDWKKAEEYVKAGKGRKVKTQYAHNKWNEETH
TGSSKMEQEVTVLSAKELKDLCYFMPTPKSPHGCDIDPTGEYIVGSGKLAALIPVHSFSK
MLNAIKNKEFAGEYDGISILKYESTLHGEVQKPGLGPLHTEFDDKGYAYTSFFVSSEVVK
WDIKTLKVLDRQPTFYSVGHLMIPGGDSKKPFGKYLVAYNKITKDRFLPTGPELAQSAQL
YDISGDKMKLLLDFPTFGEPHYAQALPAKLIADKQVKFYDISKNKHPYVTKGEGESRVVR
DGNKVHVYMTSIRSHFAPDNIEGIKVGDEVYFHVTNLEQDWDVPHGFAIKGAENAELLIM
PGETCTLKWIPKKAGMFPMYCTDFCSALHQEMQGYVRVSPAGSSTPLLFSLNNKADNAQG
PVKKAETK
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgaagataaataaaatattaggctattcggcactatttctagggagcatctacgcccta
gaaagttgtaaacccaaagggacggaaaatgctgtagctggtgatgcagcagaaaaagta
tatgtggcaccgggtaaacatgacgaattttataattttgtcagcggtggttttaacaga
caaatgggagtctatggtttacctagcgggagattactaaaagtagttcctatattctcc
gtaaatcccgaaaatggctatggttacagtgaagaaactaagcccatgttagaaacttca
catggttttattccttgggatgaccagcatcaccttgaactttcacaaaccaatggagaa
gttgatgggcgttggatttttgctaacgctaataacacacctcgcatcgcaagagtagac
ctttctagctttaaaacagtagaagttttagaactaccaaactccgcaggaaatcattca
tctccttttattacagaaaatacagagtatgtagtagctggaactcgtttttctgtacct
actgatgatgctaatggtgatgtacccattaatagttttaaagaaaattttaaaggcgta
atttcctttgtaaaagtagataaaacaacaggagaaatgaaactggcttttcaaatagaa
gctcctggtgtcaatttcgacttatctcatgcaggcaaaggtaaatctcatggctggttc
ttcttctcttgttataattcagagcaagctaatagcctattagaagttaacgcttctcaa
tttgacaaagatttcatcatggctttagactggaaaaaagcagaagaatatgtgaaagca
ggtaaagggagaaaggtaaaaacccaatacgcacacaacaaatggaatgaagaaacccat
acaggtagttctaaaatggaacaagaagtaacggtgctgtcagctaaagaacttaaagat
ttatgctactttatgccaacacctaaatcaccacatgggtgtgatatagaccctacaggt
gagtatattgtaggttcgggtaaattagcagctctgattcctgtacatagcttcagtaaa
atgctgaatgctatcaaaaacaaagagtttgctggagaatatgacggcatttctattcta
aaatacgaatctaccctacacggagaagttcaaaaacctggtttaggtcctcttcataca
gaatttgatgataaaggttatgcttatacttcattctttgtttcttcggaggttgtaaaa
tgggatatcaaaactctcaaagttttagatcgtcaacctacattctattccgtaggacat
ttaatgattccaggtggagactctaagaaacctttcggtaaatatttggtagcttataac
aaaattaccaaagatagatttttacctacaggtccagaactagctcagtctgcacagtta
tatgacattagtggtgataagatgaaacttttactagacttccctacatttggagagcct
cattacgcacaagctcttcctgcaaaactcatcgcagataagcaagtaaaattctatgat
atttctaagaacaaacacccttatgtaaccaaaggtgaaggtgaatctagagtagttaga
gatggtaataaagttcatgtttacatgacctccatccgttctcattttgctcctgataat
attgagggtattaaagttggtgatgaagtttatttccatgtaaccaatctggaacaagac
tgggatgtccctcacggatttgcgattaagggtgcagaaaatgcagaactcctcattatg
cctggagaaacttgcacacttaagtggattccaaaaaaggcaggaatgttccctatgtac
tgtactgacttctgctctgctctacaccaagaaatgcaaggctatgtaagagtttcacca
gcaggaagttcaacacctctgttgtttagccttaacaataaagcagacaacgcccaaggt
ccagtaaaaaaagctgaaactaaataa

DBGET integrated database retrieval system