KEGG   Rickettsia akari: A1C_00205Help
Entry
A1C_00205         CDS       T00601                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
rak  Rickettsia akari
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rak00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:rak00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
28224..28364
Genome map
AA seq 46 aa AA seqDB search
MTDKKIFIVGGAEIAILCLEQNLIDEFLLTKINKNYDGDTFFPLNL
NT seq 141 nt NT seq  +upstreamnt  +downstreamnt
ttgactgataagaaaatttttattgttggaggggcagaaatagcaattctttgcctagag
caaaatcttattgatgaatttttacttaccaaaataaataaaaattatgatggagatact
tttttccctcttaatctttag

DBGET integrated database retrieval system