KEGG   Rickettsia akari: A1C_00940Help
Entry
A1C_00940         CDS       T00601                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rak  Rickettsia akari
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rak00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A1C_00940
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A1C_00940
   00650 Butanoate metabolism
    A1C_00940
  Energy metabolism
   00190 Oxidative phosphorylation
    A1C_00940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
174409..174786
Genome map
AA seq 125 aa AA seqDB search
MVYDFKVEIVKAKNSGSAKSGSHRWLSQRITGIILALCSIWLIYFMLTNKNNDINIIMWE
LKKPFNVVALLITVAISLYHSMLGMRVVIEDYISCHKLHNILIIIVQLFCIVTITTFVVA
MFYIG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgattttaaagtagaaattgtaaaagccaaaaatagcggttctgctaaaagt
ggttctcatcgttggttgtcgcaaagaataacggggattatattagctttatgttctata
tggttaatatattttatgctaactaacaaaaataatgacataaatattattatgtgggag
cttaaaaagccttttaacgtagtagcattgttaattacggtggctatttcgttgtatcat
tcaatgcttggtatgcgtgtagtgattgaggattatataagttgtcacaaattacataat
atcttgattataatagtgcaattattttgcattgtgactattactacttttgtagtagcg
atgttttatattggatga

DBGET integrated database retrieval system