KEGG   Rickettsia akari: A1C_01295Help
Entry
A1C_01295         CDS       T00601                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rak  Rickettsia akari
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:rak01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:rak00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:rak00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(240318..241520)
Genome map
AA seq 400 aa AA seqDB search
MSVKIIVPLLGESVTEATIAKWYKKEGDSVKTDELLLEIETEKVTLEVNAPCNGTIGKIS
KTDGANVAVGEEIGDINEGAAVNTAGTHTESAKAQEVTQPTSEKPVDRPAMVNNILAPSV
QKLVTENKLDPNNIKGTGKDARITKSDVLETINTKSAATSTTVNKTNEERVQRVRMSRLR
KTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHDVKLGFMSFFVKATIEA
LKLIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLVVPVVRDADQMGFAEVEKAIGTLAKK
AREGKLSMADLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDGKIEIH
PMMYIALSYDHRIIDGKEGVSFLVKIKQLIENPEKLLLNL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttaaaattatagtaccgttgcttggagagtccgtaacagaagcaactattgcc
aaatggtataagaaagaaggtgattcggttaaaaccgatgaattactgttagaaattgaa
accgaaaaagtgactttagaagttaatgctccttgtaacggtactataggtaaaatatcg
aaaactgatggtgcaaatgtagcagttggagaagaaataggagatataaatgaaggtgca
gctgttaatactgccggtactcatactgaatctgctaaagctcaagaagttacgcaacct
acttcagaaaagcctgtagacagacctgccatggttaataatattcttgctccttccgta
caaaaattagttaccgaaaataagcttgaccccaataatataaaaggaacaggtaaagat
gctagaattaccaaaagcgacgtgcttgaaacaataaacacaaagtctgctgctacttct
actacagtaaacaaaactaacgaagaaagagtacagcgtgttcgtatgtcacgcttacgt
aaaactattgcacagcgtttaaaagattcacaaaatacagcagctattttgactactttt
aatgaaatcgatatgtcaaaagtaattgcattgcgtaatcaatataaggaagagttcgag
aaaaagcacgatgtgaaacttggctttatgtcgttttttgttaaagcaacaattgaagct
ttaaagcttattccatcggtcaatgctgaaatagatggtgatgatttagtatataaaaat
tactatgatataggtgtagctgtcggaacagagcaaggacttgttgtaccggttgttagg
gatgccgatcaaatgggatttgctgaggtagaaaaagctataggaactttggctaaaaaa
gctcgtgagggtaaactttctatggctgatttgtcagggggaacattttcgatttctaac
ggaggcgtatatggctcattattatctacaccgattattaatcctcctcaatcaggtatt
ttaggattacataaaactgaggaaagagctgtagttatagacggtaaaattgaaatacat
ccgatgatgtatatagctttatcttacgatcatcgtataattgacggaaaagaaggagta
tcgttcttggtaaaaattaagcagcttattgagaaccctgagaagttactactgaatttg
taa

DBGET integrated database retrieval system