KEGG   Rickettsia akari: A1C_01840Help
Entry
A1C_01840         CDS       T00601                                 

Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
rak  Rickettsia akari
Pathway
rak02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rak00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A1C_01840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Flagellin_N
Motif
Other DBs
NCBI-ProteinID: ABV74679
UniProt: A8GMQ4
Position
complement(342546..343073)
Genome map
AA seq 175 aa AA seqDB search
MSGKELNKIVAAILSASLIAMMVGFVANILYKPTLELQHRGYSVAVQASSDNQDTTALEQ
APINIPQLMKTANANNGREIAKKCLMCHSLDKDGPNKLGPHLWDVAGRPKGSIADYKYSP
ALSKLSGVWDDDSLFAFLHKPSSYAPGTKMSFAGISRPRDIADVILFLKTYVHDK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagaattaaataaaattgttgcagccatcctatctgctagtttaattgct
atgatggttggatttgttgcaaatatattatataaacccactctagagttacagcatcgc
ggctacagcgttgcggttcaagcatcatcagacaatcaagatactaccgcactagagcag
gcaccaatcaatataccgcaattgatgaaaacagcgaatgccaataacggtcgtgaaata
gccaagaaatgtttaatgtgtcattctcttgataaagacggtccaaataaactaggaccg
catctttgggatgtagcaggcagaccaaaaggaagcatagcagactataaatattcccct
gctctatcaaaactcagtggcgtatgggatgatgatagtttatttgctttcttacataaa
ccaagtagctatgcaccaggaactaaaatgtcctttgccggtatctcaagaccacgagac
atagctgacgtcatattatttttaaaaacttatgttcatgataaataa

DBGET integrated database retrieval system