KEGG   Rickettsia akari: A1C_02870Help
Entry
A1C_02870         CDS       T00601                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rak  Rickettsia akari
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rak00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
520423..520995
Genome map
AA seq 190 aa AA seqDB search
MSKPTREEATEAVRTLLKFIGEDPTREGLLKTPDRVINSYTEIFSGYGKDVEEILNTKFY
DTCNFQDFISLEGIKFTSFCEHHMLPFNGTVHIAYIPDNCIVGISKLARIVNIFAKRLQI
QEKMTVQIAESVQENLKPLGVAVKIAALHSCMSMRGVMQDHSIMNTMHYTGIFAEQQKYR
HEFLNLTTKR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaccaactagagaagaagctacagaggcagtaagaacgttactaaaattcatt
ggtgaagatccaactagggaagggctacttaaaacacctgatagagtaattaacagctat
acggaaatattttccggttatggaaaggatgtagaggaaatattaaatacaaaattttac
gatacttgtaattttcaggactttatctcactagaaggcataaaatttacctctttttgc
gaacatcatatgttaccttttaacggtacggtacacatagcttatattcctgataactgt
attgtcggcataagcaagttagcacgaatagtaaatatttttgctaaaaggctgcaaatt
caagaaaaaatgacggtacaaatagcagaaagcgtacaggagaatttaaagccgcttggc
gttgccgttaagattgctgccttgcatagttgtatgtctatgcgtggagtgatgcaggat
catagcataatgaataccatgcattatacgggtatatttgccgagcagcagaaatatcgc
catgagtttttgaatcttaccacgaaaagataa

DBGET integrated database retrieval system