KEGG   Rickettsia akari: A1C_02895Help
Entry
A1C_02895         CDS       T00601                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rak  Rickettsia akari
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rak03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
523128..523739
Genome map
AA seq 203 aa AA seqDB search
MIGKLSGKIDAQGDDYIIIDVNGVGYLVYASGKTLGKLSEGEFYKLFIETHVREEHIHLY
GFLTIEEKNFFNLLQSVNGIGTRMALSILSNLTPTDIQIAINNEDKDIFKAISGVGAKLA
ERIVLELKGKVAKISTGAAIINDSLNIKNITSVASNEVIKALVNLGFSRFEAQNSVQGIV
IQNPEISIDELIKTALKNRNAGL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtaaattaagtggtaagattgatgcccaaggtgatgattacattataattgac
gtaaatggggtaggatacttagtctatgcttcgggtaaaactttaggtaaactttcagaa
ggggaattttataaactatttatcgaaacccatgttagagaggaacatattcatctttac
ggttttctaactatagaagagaagaatttttttaatttgctgcaatccgtgaacggtatt
ggtacgagaatggctctatctattttatcaaatctaactcctacggatattcaaattgct
ataaataatgaagataaagatatatttaaagcaatatctggcgtcggtgctaaacttgct
gagcgtatagttctagagctgaaaggtaaagtagcgaaaatatcaactggtgcggctatt
atcaacgatagcttaaatatcaaaaatattacatcggtcgcaagcaatgaagtaataaaa
gctctagtaaatctaggcttttctagatttgaagctcaaaactccgttcaaggcattgtt
atccaaaaccctgaaatctctattgatgaattaatcaaaacagccctgaaaaatcgcaat
gctggcctttaa

DBGET integrated database retrieval system