KEGG   Rickettsia akari: A1C_03220Help
Entry
A1C_03220         CDS       T00601                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rak  Rickettsia akari
Pathway
rak00020  Citrate cycle (TCA cycle)
rak00640  Propanoate metabolism
rak01100  Metabolic pathways
rak01110  Biosynthesis of secondary metabolites
rak01120  Microbial metabolism in diverse environments
rak01130  Biosynthesis of antibiotics
rak01200  Carbon metabolism
Module
rak_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rak_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rak00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A1C_03220 (sucC)
   00640 Propanoate metabolism
    A1C_03220 (sucC)
   00660 C5-Branched dibasic acid metabolism
    A1C_03220 (sucC)
Enzymes [BR:rak01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     A1C_03220 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABV74930
UniProt: A8GNF5
Position
complement(586842..588002)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQAKEILRKYGVPTSTGLVVTKTEKINETIDKLNTEVYVVKAQIHAGGRGKAGGV
KVVKSKEEAKKVAHDMFGINLVTHQTEPQGQKVNCLYIESGCDILKEYYFSIVFDRSASC
ITFIASTEGGVDIEEVAAKTPAKIIKFSVDPATGLQDFHMRGIAYELGFKDNQAKQMKEI
VKSVYNAFVETDAAQIEINPLIVQTDGNLLALDAKITFDDNGLFKHPNITAMRDHDEEDP
LETRAANAGLSYVKMGGNIGCMVNGAGLAMATMDIIKLYGASPANFLDVGGGADRERVKE
ALKIILSDKEVQGILVNIFGGIMRCDIIAEGIIAAAKDIGIKVPLVVRLAGTNVEKGEEI
LSNSGLDIIPAHDLADAANKIVAAIR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaatatcaagcaaaagagattttgagaaaatacggcgtacctacttcc
actggactcgttgttacgaaaaccgagaagattaacgaaaccatagataagttaaataca
gaagtatatgtggttaaagcacaaatacatgccggcggtagaggtaaagcaggcggtgtt
aaggttgttaagagtaaagaagaagcaaaaaaagtggctcatgacatgtttggtattaat
ttagtaacacatcaaacagaacctcaaggacaaaaagtaaattgtctttatatcgaatca
ggttgtgatatcttaaaagaatattatttcagtatagtatttgatagatcggcaagttgt
attactttcatagcttctaccgaaggaggagtcgatattgaagaagtagcagcaaaaact
cctgcaaaaattattaaattttctgttgatcctgcaaccggtttacaagattttcatatg
cgtggtatagcttatgagctaggttttaaggataaccaagctaaacaaatgaaagaaata
gtaaaatcagtgtataatgcttttgttgaaactgatgctgcacaaattgaaatcaacccg
ttaattgtacaaacggacggaaatttactcgctttagacgcaaaaatcacttttgatgat
aacggcttattcaaacatccaaatattacggcaatgcgtgatcacgatgaggaagatcct
ttagaaactagagcggcaaatgcggggcttagctatgtaaaaatgggcggtaatatcggt
tgtatggttaacggtgcgggtcttgctatggctactatggatattattaagctttacggt
gcgtcacctgcaaatttcttagatgttggcggcggggctgatcgtgagcgtgtaaaagaa
gctttaaaaataattttatccgataaagaagtgcaagggatcttagttaatattttcggc
ggtattatgcgttgtgatattatagcggaagggattattgcagctgcaaaagacataggt
ataaaagtgccattagtcgtccgtttagccggtactaacgttgaaaaaggcgaagaaatt
ttatcaaattccggtttagacataataccggcacatgatttagcagatgcagcaaataag
atagtcgcggctattaggtag

DBGET integrated database retrieval system