KEGG   Rickettsia akari: A1C_03255Help
Entry
A1C_03255         CDS       T00601                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rak  Rickettsia akari
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rak00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    A1C_03255 (recR)
DNA repair and recombination proteins [BR:rak03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      A1C_03255 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
593442..594065
Genome map
AA seq 207 aa AA seqDB search
MIYTPTMNKTNDHEIDQLIYLFSKLPGLGSRSARRIVLYLLQDKDVRLKSLINNLVEIDK
KIVKCKICGNMDTESICSICSSKYRDKSVIAVVETVAELWAMERSGNFKGLYHVLGHNLS
AASRQNPSILRLPELLKRCFAENIKEVIIATNSTLEGQTTAYFITEYLKEHPAKISRLAS
GIPIGGELDYLDEGTLSAAINLRQPFE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgatatatactccgactatgaataaaacaaatgatcatgaaatagaccagctgatttat
cttttttcaaaattgcctgggcttggtagtaggtcagcaagacgtatagtgctttatcta
ctacaagacaaagatgttaggttaaaaagcctgattaataaccttgtagagatagataag
aaaatagtaaaatgcaagatttgtggtaatatggatacggaaagtatttgctctatttgc
tcttctaaatatagagataaatcggttattgctgttgttgaaaccgtagctgaattatgg
gcaatggagcgtagcggtaattttaaaggtttatatcatgtactaggccataatttatcg
gcggctagtaggcaaaatcctagcatactaaggttacctgaactacttaaaagatgtttt
gcagaaaatattaaagaagttattattgctactaattctactttagaaggtcaaactact
gcctattttattactgaatatttaaaagagcatcctgctaaaatttctcgccttgctagc
ggtatacctatcggaggtgaacttgattatctagacgaaggtactttatctgccgctatt
aacctacgccaaccttttgagtaa

DBGET integrated database retrieval system