KEGG   Rickettsia akari: A1C_04325Help
Entry
A1C_04325         CDS       T00601                                 

Definition
3-hydroxyacyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rak  Rickettsia akari
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rak00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    A1C_04325
   01212 Fatty acid metabolism
    A1C_04325
  Carbohydrate metabolism
   00640 Propanoate metabolism
    A1C_04325
   00650 Butanoate metabolism
    A1C_04325
  Lipid metabolism
   00071 Fatty acid degradation
    A1C_04325
   01040 Biosynthesis of unsaturated fatty acids
    A1C_04325
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A1C_04325
   00310 Lysine degradation
    A1C_04325
   00380 Tryptophan metabolism
    A1C_04325
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A1C_04325
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A1C_04325
   00281 Geraniol degradation
    A1C_04325
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    A1C_04325
Enzymes [BR:rak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     A1C_04325
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     A1C_04325
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     A1C_04325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(776810..778975)
Genome map
AA seq 721 aa AA seqDB search
MQNEIKKICVIGSGVMGSGIAALIANSSHKVVLLDIIAKDSDDPNKIVKNAIENLHKQKP
PPLSCPDKANFITIGTLEHDLDLITECDLIIEVIVEKLEIKHQLYNKLIPYLKEEAIIAS
NTSTLPLKRLKENLPDNIKSRFVITHFFNPPRYMELLELIIDHMVKVEAIERVSEFLTKT
LGKTIVRCNDTPGFIANRVGCFLLELVVRKAISQKLNFVALDKIFTTCLGLPSTGIFGLY
DLIGHDVMKLISSSLLAALPAKDAYHKIYVNTPVLDKMIGRKLIGRKGCGGFYRLSVSNG
KKIQEVININDLSYSPVQKVDISFKNLDELLASDSVYGKFFTEIITEFYVYLASLVPSVT
DNIYDIDAAMKLGYSWKYGPFELLTIAAKDGWNSIIKNTDLMHIPLPQYLGNKEYQKIDK
QKFNSHKDILKESQIVLENDSAKLINYRENLVFVITTKMNCLNHNVFYLLQEAASKAEND
GKNLYIYPQGNHFSAGADLKLLLSYIEDKNFHDLENLLKLGQQTMLHLKYSAAHIVSCAK
GVALGGGCELLLYSSYIVANNELSAGLVELGVGLIPGWGGVTVMFARARGDKTKLIRNVR
NIIEQNKTSSADYVKADYDVENMQVNMNKHYILDEALKLNLSKKIVPATHKVTLPKINLA
TEIDISKYNDLQNKVLSKFQTIIDQHNETNEESLFAYERDIFLELAKDPKTIEKLKVVLG
H
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatgaaataaaaaaaatttgtgttatcggttcaggggtaatgggttcagggatt
gcagcgttaattgctaattcctctcataaagtcgtattactggatattatcgctaaagat
tctgatgatcctaataaaatagtaaaaaatgctatagagaatttgcataaacaaaaacct
ccccctttatcttgtcccgataaagcaaatttcattaccatcggtactttagaacatgat
ttagatttaattacagaatgtgatttaattattgaagttattgttgagaagttagaaatc
aagcaccaattatataacaaacttattccttatcttaaagaagaggcaattattgcttct
aatacttctacattacctcttaaaagactaaaagagaatttaccggataatatcaaatcg
agatttgttattacgcatttcttcaacccgccaagatatatggaactgcttgagttaatt
atagaccatatggtaaaggttgaagccatagaaagagtatcagagttcttaacgaaaacg
cttggtaaaactatagtcagatgtaatgatacacctggttttattgctaatagagtaggg
tgttttttactggagttagtagtccgcaaagcgataagtcaaaagcttaattttgtagct
ttggataaaatatttactacatgtttggggctgccgagtaccggaatttttggtttatat
gatctaataggacatgacgtcatgaagttaatatcaagctcattacttgctgcccttcct
gcaaaggatgcttatcataaaatatatgtcaatactcccgttcttgataagatgattggg
aggaagttaattgggcgtaaaggctgtggtggattttatcgtttatcggtatcaaatggc
aaaaagattcaagaagttatcaatataaacgacttatcatatagtcctgttcaaaaagta
gatatttcatttaagaatcttgatgagttactagctagcgattcagtttacggtaaattt
tttactgaaattatcacagaattttatgtttatttagcaagcttagtaccatctgtaacc
gataatatctatgatatcgatgctgctatgaagcttggttacagttggaaatacggtcca
tttgaattattgaccatagcagctaaagacggctggaattcgatcattaaaaataccgat
ttaatgcacatcccacttccgcaatatttaggtaataaagaatatcaaaaaatcgataaa
caaaaatttaattctcacaaagatattttaaaggaaagtcagatagtattagaaaacgat
tctgcaaagctaataaattatcgtgagaatttagtgtttgttattactacgaaaatgaat
tgtttaaatcataatgtgttttatttactgcaagaagcagcaagtaaagctgaaaatgac
ggcaaaaatctttatatctatccgcaaggaaatcatttttctgctggtgcggatttaaag
cttcttctctcctatattgaggataaaaattttcatgatttagagaatttactaaagctg
ggacagcaaaccatgcttcacttaaaatattctgcagctcatattgttagttgtgccaaa
ggagtagcccttggaggcgggtgtgagctgctattgtactcaagctatattgtcgcaaat
aatgaactgagtgctggacttgtagaacttggagtcggtttaatacctgggtggggcggt
gttaccgtaatgtttgctcgcgctagaggagataaaactaaactaattagaaatgttaga
aatattatagagcagaataaaacaagttcagccgattacgtgaaagcagattatgatgta
gagaatatgcaagtaaatatgaacaagcattacattctcgatgaagctttaaagctgaac
ctatctaaaaaaatagtaccggctacccataaagttactttgcccaaaatcaatttagca
actgaaatagatatatcaaaatataacgatctacaaaataaggtacttagcaagtttcaa
accattatagatcaacataatgaaacgaatgaagaatcgctatttgcctatgagcgtgac
atatttttagaacttgcaaaagatccaaaaactatagagaagttgaaagttgtgttgggg
cattga

DBGET integrated database retrieval system