KEGG   Rickettsia akari: A1C_06750Help
Entry
A1C_06750         CDS       T00601                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rak  Rickettsia akari
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rak01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:rak00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1212663..1213784)
Genome map
AA seq 373 aa AA seqDB search
MIGFKSVTPENDGAIEYIDDLLKQHGFKTEIKIFGDFKSEQVTNLYAIFGRNEPNICFVG
HVDVVPVDNHALWHNSSPFKASKQDGKIYGRGAVDMKGAIACFLAASLDFIKNNAGFKGS
ISFLLTSDEEGKAKHGTKEMLQYIYDQGYKVDFAIVGEPTCEKEIGDTIKIGRRGSVNFK
LNIDGLAGHVAYPHKANNPLPCLIKILHELTNIRLDEGTEFFQNSNLEVTNIDVGNETSN
VIPASTEASFNIRFNNLHSAETLAKQVEEIIKRYCKEYKVDYKLEYSSFAGSFIQNPSAK
IKEFAKVVEHTLKIKPKFSTSGGTSDARFVKNYCPLVEFGLLSETAHKINEYTKISDLQK
LYDVYYNFLIKIL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
ttgattggttttaagtctgtaactcctgaaaacgatggtgctattgagtatattgatgat
ttgcttaaacagcacggctttaagaccgaaataaaaatattcggcgattttaaaagcgag
caagtcactaacctttatgctatttttggtagaaatgagcctaatatttgctttgttggt
catgtagatgtagtgccggtagataatcatgcgctttggcataattcgagtccatttaag
gctagcaagcaagatggtaagatatatggcagaggtgcggtggatatgaaaggggctata
gcgtgctttctagcagctagcttagattttataaaaaataatgccggttttaaaggttct
attagtttcttacttactagtgatgaagaggggaaagcaaagcatggcactaaagaaatg
ctgcaatatatttatgaccagggatataaggtagattttgctattgtcggtgaacctact
tgtgaaaaagaaataggcgatacaattaagatcggccgaagaggaagtgttaactttaaa
ttaaatatagacggtttagcagggcatgtagcttatcctcataaagcaaataatccgttg
ccttgcttaataaaaatattgcatgagttaacgaatataagacttgatgaaggtactgaa
ttttttcaaaattcaaatcttgaagtaacgaatattgatgttggtaatgagacctcaaat
gtaattccggcaagtactgaagcatctttcaatatacgttttaataatttacatagtgca
gaaactttagcaaaacaggtagaagaaattattaaacgatattgcaaagaatataaggta
gattataagttagaatatagtagttttgctggaagttttattcagaatcctagtgctaaa
ataaaagaatttgctaaagtagtagagcatactcttaaaataaaacctaaattctctaca
agcggcggtacgtcagatgcaagattcgtcaaaaattattgtccgttagtagaattcggt
ttattatccgaaacggcacataaaataaacgaatacacaaaaattagcgatttacaaaaa
ttatatgatgtgtattataattttttgattaaaatactttga

DBGET integrated database retrieval system