KEGG   Rickettsia akari: A1C_06750Help
Entry
A1C_06750         CDS       T00601                                 

Definition
(RefSeq) succinyl-diaminopimelate desuccinylase
  KO
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rak  Rickettsia akari
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rak00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A1C_06750
  Amino acid metabolism
   00300 Lysine biosynthesis
    A1C_06750
Enzymes [BR:rak01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     A1C_06750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1212663..1213784)
Genome map
AA seq 373 aa AA seqDB search
MIGFKSVTPENDGAIEYIDDLLKQHGFKTEIKIFGDFKSEQVTNLYAIFGRNEPNICFVG
HVDVVPVDNHALWHNSSPFKASKQDGKIYGRGAVDMKGAIACFLAASLDFIKNNAGFKGS
ISFLLTSDEEGKAKHGTKEMLQYIYDQGYKVDFAIVGEPTCEKEIGDTIKIGRRGSVNFK
LNIDGLAGHVAYPHKANNPLPCLIKILHELTNIRLDEGTEFFQNSNLEVTNIDVGNETSN
VIPASTEASFNIRFNNLHSAETLAKQVEEIIKRYCKEYKVDYKLEYSSFAGSFIQNPSAK
IKEFAKVVEHTLKIKPKFSTSGGTSDARFVKNYCPLVEFGLLSETAHKINEYTKISDLQK
LYDVYYNFLIKIL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
ttgattggttttaagtctgtaactcctgaaaacgatggtgctattgagtatattgatgat
ttgcttaaacagcacggctttaagaccgaaataaaaatattcggcgattttaaaagcgag
caagtcactaacctttatgctatttttggtagaaatgagcctaatatttgctttgttggt
catgtagatgtagtgccggtagataatcatgcgctttggcataattcgagtccatttaag
gctagcaagcaagatggtaagatatatggcagaggtgcggtggatatgaaaggggctata
gcgtgctttctagcagctagcttagattttataaaaaataatgccggttttaaaggttct
attagtttcttacttactagtgatgaagaggggaaagcaaagcatggcactaaagaaatg
ctgcaatatatttatgaccagggatataaggtagattttgctattgtcggtgaacctact
tgtgaaaaagaaataggcgatacaattaagatcggccgaagaggaagtgttaactttaaa
ttaaatatagacggtttagcagggcatgtagcttatcctcataaagcaaataatccgttg
ccttgcttaataaaaatattgcatgagttaacgaatataagacttgatgaaggtactgaa
ttttttcaaaattcaaatcttgaagtaacgaatattgatgttggtaatgagacctcaaat
gtaattccggcaagtactgaagcatctttcaatatacgttttaataatttacatagtgca
gaaactttagcaaaacaggtagaagaaattattaaacgatattgcaaagaatataaggta
gattataagttagaatatagtagttttgctggaagttttattcagaatcctagtgctaaa
ataaaagaatttgctaaagtagtagagcatactcttaaaataaaacctaaattctctaca
agcggcggtacgtcagatgcaagattcgtcaaaaattattgtccgttagtagaattcggt
ttattatccgaaacggcacataaaataaacgaatacacaaaaattagcgatttacaaaaa
ttatatgatgtgtattataattttttgattaaaatactttga

DBGET integrated database retrieval system