KEGG   Ruminococcus albus: Rumal_0080Help
Entry
Rumal_0080        CDS       T01387                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ral  Ruminococcus albus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ral00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rumal_0080
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Rumal_0080
Enzymes [BR:ral01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Rumal_0080
Two-component system [BR:ral02022]
 CheA family
  CheA-CheYBV
   Rumal_0080
Bacterial motility proteins [BR:ral02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Rumal_0080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(75098..76072)
Genome map
AA seq 324 aa AA seqDB search
MTIYIISDNIMICELLSARLAVLLPAGTIIATGMRKNAKAMIAQSKPSAIVLDIDGGEAS
DAAAFISDLCPRYSIPIIAVTANKGPRSSLFTAGAIDVVQHQIDAGADEKFLQRVSQSIK
SCTSAVRMRLSPQKTNEDQVIVIGGSTGSTNALPELLKDLPSNSPPIVCVLHMPVGYTKI
YAAQLNASLPLDVSEAVSGTYLTRGMVVIAEGGRHLRLFRDRKGYFITSEEGVKVNGHCP
SVDVLFSSAAYAAKENAIGIILTGMGCDGAKGMLDMRKLGAYNIAESEKTAVVYGMPRVA
AENGAANISLPLDEIAAHVIAKIQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgactatatacatcatttcagataatataatgatatgcgagctgctctcagccaggctc
gcagtacttctgcctgcaggcactatcatcgctaccggtatgcgcaagaacgccaaggct
atgatagctcagagtaaaccctctgctatagtactggatattgacggaggcgaagcatcc
gatgccgctgccttcatttcagatctttgtccaagatactccataccgataatcgcagtt
accgcaaataaaggtccgcgttcttcactttttactgcaggtgccatagatgtagtacag
catcagatagatgcaggtgcagatgaaaaattcctgcaaagggtcagccagagtataaaa
agctgtaccagtgctgtaaggatgcgtctcagtccccagaagacaaacgaagatcaagtg
atagttataggcggttcaacaggcagcaccaacgctttacccgagctgcttaaagatctg
ccttccaacagcccgccgatagtatgcgttctgcatatgcccgtaggctataccaagatc
tatgccgcccagctgaacgcttcacttccgctggatgtaagcgaggcagtttcgggaaca
tacctcacacgcggcatggtggtgatagctgaaggtggcagacatctgcgactgttccgc
gacagaaagggctattttatcacaagcgaggaaggcgtaaaggtcaacggccactgtccc
tctgtggatgtgcttttctcatcggcagcctatgcggcaaaagaaaacgccataggcatc
atactgacaggtatgggctgtgacggtgccaagggtatgctggatatgcgaaagctcggt
gcatacaacatagcagaatccgaaaagactgcggtagtatacggtatgcccagggtggct
gcggaaaacggtgctgctaatataagtcttccgctggacgagatagcagcccatgtaata
gcaaaaatacaatga

DBGET integrated database retrieval system