KEGG   Ruminococcus albus: Rumal_0088Help
Entry
Rumal_0088        CDS       T01387                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.4)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ral  Ruminococcus albus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rumal_0088
   01230 Biosynthesis of amino acids
    Rumal_0088
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rumal_0088
  Energy metabolism
   00680 Methane metabolism
    Rumal_0088
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rumal_0088
Enzymes [BR:ral01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Rumal_0088
Exosome [BR:ral04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Rumal_0088
  Exosomal proteins of melanoma cells
   Rumal_0088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(85996..86745)
Genome map
AA seq 249 aa AA seqDB search
MSMKLVLIRHGESEWNKENKFTGWTDVELSEAGVEEAKKAGKVLKEAGYDFDICYTSYLK
RAIHTLNNVLAEMDREWLPVVKSWRLNERHYGALQGLNKSETATKYGEEQVKIWRRSFDI
PPMALTEDDERNPKKDPKYREEDPAELPLQESLKDTIARAVPYFEEEIKPQIKSGRRVVI
AAHGNSLRALVKYFDGLSDEEIINVNIPTATPLVYEFDDEFNVIGKEYLCDPDELAAKMN
SVANQGKAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgaaactggtactcatccgccacggcgaaagcgagtggaacaaggagaacaag
ttcacgggctggactgatgttgagctgagcgaggcaggtgttgaggaagcaaagaaggcc
ggcaaggtcttgaaagaggcaggctatgactttgatatctgctatacctcatacctcaaa
agagctatacataccctcaacaatgtactggccgagatggacagagagtggctgcccgta
gttaagagctggaggctcaacgaaaggcactacggcgctctccagggtctgaacaaaagc
gaaactgccactaaatacggcgaggagcaggtgaagatctggagaagatcctttgatatc
cctccgatggcactaaccgaggatgacgaaaggaatccgaagaaggacccgaagtaccgc
gaggaagatcccgcagagttacctttgcaggaaagtctcaaggataccatcgccagagct
gttccctactttgaagaggagataaaacctcagataaaatcgggcagacgtgtggtgata
gcagctcacggcaacagcctgagagctttggtaaagtactttgacggtctcagcgatgag
gagataatcaatgtgaatatacctacggcaacaccgctggtatatgaatttgatgacgaa
ttcaacgtgatcggcaaggagtatctgtgcgaccccgatgagcttgctgcaaaaatgaac
agtgtggcaaatcagggcaaagcaaagtaa

DBGET integrated database retrieval system