KEGG   Ruminococcus albus: Rumal_0090Help
Entry
Rumal_0090        CDS       T01387                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ral  Ruminococcus albus
Pathway
ral00010  Glycolysis / Gluconeogenesis
ral00051  Fructose and mannose metabolism
ral00562  Inositol phosphate metabolism
ral01100  Metabolic pathways
ral01110  Biosynthesis of secondary metabolites
ral01120  Microbial metabolism in diverse environments
ral01130  Biosynthesis of antibiotics
ral01200  Carbon metabolism
ral01230  Biosynthesis of amino acids
Module
ral_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ral_M00002  Glycolysis, core module involving three-carbon compounds
ral_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rumal_0090
   00051 Fructose and mannose metabolism
    Rumal_0090
   00562 Inositol phosphate metabolism
    Rumal_0090
Enzymes [BR:ral01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rumal_0090
Exosome [BR:ral04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rumal_0090
  Exosomal proteins of bladder cancer cells
   Rumal_0090
  Exosomal proteins of melanoma cells
   Rumal_0090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADU20652
JGI: Rumal_0090
UniProt: E6UBR0
Position
complement(87483..88259)
Genome map
AA seq 258 aa AA seqDB search
MKKSVRKAIIAGNWKMNKTRPEAKELLEAIKPLVANAEGNVEVIACVPFTNLETAVNVTA
GSNVKVGAENVHFEKSGAFTGEISADMLTELGVEYVVLGHSERRQYFGETDETVNKRTKA
ALAAGLKPIVCVGELLWERECNITEEVIARQIKLDLFDVSAEDVKKTVIAYEPVWAIGTG
KTATADQAEEVCAFIRATLAKLYDEATAQAVTIQYGGSMNAGNAAELLSKENVDGGLIGG
ASLKAADFNTIVQAAVNG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatccgtaagaaaagctatcatcgcaggtaactggaagatgaacaagacccgt
cccgaggctaaggaactgctggaggctatcaagcccctcgtagcaaatgcagagggcaac
gttgaggtcatcgcttgcgtacctttcaccaacctggaaactgctgtaaatgttactgca
ggctctaacgtaaaggtaggcgctgagaacgttcacttcgagaagagcggcgctttcact
ggtgagatatccgctgatatgctgacagagctgggcgttgagtacgttgttctcggtcac
tccgagagaagacagtacttcggtgagactgatgagactgttaacaagagaacaaaggct
gctctggctgcaggtctgaagcctatcgtttgcgtaggcgagctgctctgggagcgtgag
tgcaacatcactgaggaagttatcgctcgtcagatcaagctggatctcttcgacgtatct
gcagaggacgttaagaagactgttatcgcttatgagcctgtatgggctatcggcacaggc
aagactgctactgctgaccaggctgaggaagtttgcgcattcatcagagctacacttgct
aagctgtatgacgaagctaccgctcaggcagttactatccagtacggcggatccatgaac
gcaggcaacgctgctgagctgctcagcaaggagaacgttgacggcggtcttatcggcggc
gcttcactgaaggctgctgacttcaacactatcgtacaggcagctgtaaacggctaa

DBGET integrated database retrieval system