KEGG   Ruminococcus albus: Rumal_0146Help
Entry
Rumal_0146        CDS       T01387                                 

Definition
(GenBank) Alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
ral  Ruminococcus albus
Pathway
ral00052  Galactose metabolism
ral00561  Glycerolipid metabolism
ral00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Rumal_0146
  Lipid metabolism
   00561 Glycerolipid metabolism
    Rumal_0146
   00600 Sphingolipid metabolism
    Rumal_0146
Enzymes [BR:ral01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Rumal_0146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C GHL10 Glyco_hydro_31
Motif
Other DBs
NCBI-ProteinID: ADU20708
JGI: Rumal_0146
UniProt: E6UCB6
Position
complement(147282..149492)
Genome map
AA seq 736 aa AA seqDB search
MSITYNEKTRSFKLRANNTDYMFKVINGEYLGHVYYGKKVPDEDMDWLLRLDESPFTPET
NDRDRAVYLDTTPFEYPCFGIGDYRESTLKILDSEGMSSCDLRYVSHRIYDGKPALEGMP
ATFATEKSPAQTLEITMEDAHTGLEAVLVYSVFENLDAITRSVRFTNTSDKPLKLTRALS
ACVEFDTDKMDMITLNGSWARERHIERAPLHHGKQSIDSCRGESSHQNNPFVALCAHNAD
EDMGEVFGFNFVYSGNFFAQAEVTQHKKTRFVMGINPLDFEWLLESGETFTAPEVVMVHS
DEGIGKMSRTFHDLYRENLIRGEYKDKRRPILINNWEATYFNFNTEKIISIAKEASRLGI
EMLVLDDGWFGHRDSDNSSLGDWFVYEKKLEGGLKHLVEEVNKLGMKFGLWFEPEMISPD
SDLYRAHPDWAIQIKGRPLTLCREQYVLDYSRKEVRDYVYSMMKNILDNANIEYIKWDMN
RQLTEVGSAALPVERQRELWHRYVLGVYDLMGRLTADYPHILLENCSGGGARFDPAMLYY
SPQIWCSDDTDAIERLKIQHGTSICYPCSAMGAHVSDCPNHTVGRNTPFKTRGHVAMVGT
FGYELDVTRIPQEDRDMIPAQIEEFKKYNPLVRTGDHYRIGNMFEDNTWDAWMFVAKDKS
EALFEFVQVMARPNMRSRRIKLKGLDPDAYYYEESEPDKLISGAALMNAGINCAKIWGAD
GISGDYSSKILHYIKH
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgagtataacctacaacgaaaaaacacgttcattcaaacttcgcgccaacaacaccgac
tatatgttcaaagtgataaacggcgaatatctcggacatgtttactacggcaaaaaagtc
cccgatgaggatatggactggctgctgcgccttgatgaaagccccttcacccccgagacc
aatgaccgcgacagagctgtgtatctcgataccactccatttgaatatccctgcttcggt
atcggagactaccgcgaaagcacgcttaaaatacttgacagcgaaggtatgtcctcctgc
gacctgagatatgtttcccacaggatatatgacggcaagcctgctctcgagggtatgccg
gcaactttcgccaccgaaaaaagccctgcacagactcttgaaatcaccatggaagatgcc
cacacaggacttgaagctgtgctggtatattctgtatttgaaaaccttgatgctatcacc
cgttcggtgagatttacaaacacctcagacaagccccttaaactaacccgtgccctttct
gcctgcgttgaattcgataccgacaagatggatatgataacgctgaacggttcatgggca
agggagcgccatattgaacgtgcacccctccaccacggcaagcagagcatagattcctgc
cgcggcgaatcttcccaccagaacaacccattcgttgcactgtgcgcacataatgcagac
gaggatatgggagaggtcttcggtttcaacttcgtttattcgggcaacttcttcgctcag
gcagaagtcacacagcacaaaaagacacgtttcgtcatgggcataaatccccttgatttt
gaatggctccttgaatctggcgaaactttcaccgcccccgaggtagtaatggtacactcc
gatgagggcataggcaaaatgtcgcgcaccttccatgacctctaccgcgagaaccttatc
cgcggcgagtataaggacaagcgccgacccatacttatcaacaactgggaggctacctac
ttcaacttcaacaccgagaagataatctcgatcgcaaaggaggcctccaggctgggcata
gagatgctcgttctggatgacggctggttcggtcacagggattccgataactcatctctc
ggtgactggttcgtttatgaaaagaaacttgagggcggtctgaagcaccttgttgaagaa
gtcaacaagctgggaatgaagttcggtctttggttcgagcccgaaatgatatctcccgat
tccgacctctaccgcgctcaccccgactgggctatacagataaaaggcagacccctgact
ctctgccgcgagcagtacgtacttgattactcccgcaaggaggtacgcgactacgtttac
tccatgatgaagaatatactcgacaatgccaatatagagtatatcaaatgggatatgaac
cgtcagcttacagaagtcggttcagccgcactccccgtcgaaagacagcgcgaactctgg
cacagatacgtccttggtgtatatgacctcatgggcagactaaccgccgattatccccat
atattgctggagaactgctcgggcggcggtgcaagatttgaccctgctatgctttattat
tctccgcagatatggtgttccgacgataccgatgccattgagcgcctgaagatacagcac
ggcacttccatatgctacccctgttcggctatgggcgcacacgtttccgactgccccaac
cataccgtcggcagaaatactcctttcaaaacaagggggcacgttgccatggtgggaact
ttcggctatgaactcgatgtaacacgcatacctcaggaggacagggatatgatacctgcc
cagatagaggagttcaagaagtacaatcctctcgtccgcacaggcgaccactaccgcata
ggcaatatgtttgaagacaacacatgggatgcatggatgttcgttgcaaaggataagagc
gaagccctgttcgagttcgtgcaggtaatggcaagaccgaatatgcgctcacgcaggata
aagctgaaaggtcttgaccccgatgcttactactatgaggaaagcgaacccgacaagctg
atatcgggtgcggcactgatgaacgcaggtatcaactgtgcaaagatatggggcgccgac
ggcataagcggtgactactcctcaaagatactccactatatcaaacactaa

DBGET integrated database retrieval system