KEGG   Ruminococcus albus: Rumal_0252Help
Entry
Rumal_0252        CDS       T01387                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ral  Ruminococcus albus
Pathway
ral00500  Starch and sucrose metabolism
ral01100  Metabolic pathways
ral01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rumal_0252
Enzymes [BR:ral01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Rumal_0252
Exosome [BR:ral04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rumal_0252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase Alpha-amylase_C AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: ADU20809
JGI: Rumal_0252
UniProt: E6UD15
Position
complement(263117..265090)
Genome map
AA seq 657 aa AA seqDB search
MDKMPQEYEIPLYLFHNGTNYETYRFLGCHKGVKDGNDGYYFRVWAAKARAVSLVGDFNN
WDDNATPMQQLEKSEVWEVFVPGMKTFDTYKFSIVGCDGKRRCKADPYGTHMELKPQTGS
KIFDIEGYKWKDDKWQKERKTKDVYNCPMNIYEVHLNSWKSCDDGVYYSYTKFANTIIPY
LKDMGYTHIEFMPLAEFPFDGSWGYQGIGYYAPTSRFGTPHEFMAMIDLFHQAGISVILD
WVPAHFPRDEAGLFEFDGGASYEYADPKKRDHLAWGTRVFDYGRGEVKSFLISNALYWIE
QYHIDGLRVDAVASMLYLDYDRRDGEWTPNIYGGHENLEAVQFLRDLNTAVFSRCPTVLM
IAEESTAWPMVTKPVSDGGLGFNFKWNMGWMNDMLKYMSYDPIDRAFHHDMLTFSFFYAF
SENFVLPISHDEVVHGKASLVNKMYGGDVDKKFEQCKLFNAYMMAHPGKKLMFMGTEFAQ
FREWDYENGLEWFLVEEYENHRNYHAFSKRLNRFYLDHPQFWQKDFDWSGFSWIANDDFR
QSIIIFRRFDAEANEVIVLCNFVPVERKSYCFGVPYKGKYTEVFNSASPDGAPMTNGTVK
SQDVPMHGFEQSVCIDIPPFSCMYFEVKKDSEKKKATIKKAEHKKNSDKKKTAKEAE
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atggataagatgcctcaggaatatgagatacctctataccttttccacaacggaacaaat
tatgaaacataccgttttctcggctgccataaaggcgtaaaagacggaaatgacggttat
tatttcagagtatgggctgccaaggcacgcgcagtatcactggtaggcgatttcaacaac
tgggatgataacgccacacctatgcagcagcttgaaaagtcggaagtctgggaagtattc
gtcccgggcatgaagacatttgatacatataaattctccatagtcggctgcgacggcaaa
cgccgctgcaaggctgacccctatggtacacatatggagctgaagccccagaccggctca
aagatattcgatatcgaaggctataaatggaaagacgataagtggcagaaggaacgcaag
accaaggacgtttacaactgcccaatgaatatatacgaagttcacctgaattcgtggaag
tcctgcgatgacggtgtgtactattcgtataccaaatttgcaaatacgataataccttac
ctcaaggatatgggctatacccacatcgaattcatgcccctggcagaattcccctttgac
ggttcctggggttatcagggcataggctactatgcaccgacctcacgttttggtactccc
cacgagttcatggcgatgatagacctgttccatcaggcagggatatccgttatcctcgac
tgggtacccgcacattttccaagggacgaggcaggtctgtttgaatttgacggcggcgca
agctatgagtatgccgaccctaaaaagcgtgaccatctcgcatggggcacaagagttttc
gactatggaagaggagaagtaaaaagcttccttatctccaacgcgctgtactggatagaa
cagtaccatatcgacggtctgcgtgttgatgcagtagcctccatgctgtacctcgattat
gacagacgcgacggcgaatggacaccaaatatctacggcggtcacgagaacctcgaagct
gtacagttccttcgtgacctgaatacagccgtattctccagatgccccacagtgcttatg
atagccgaagaatccaccgcatggccaatggtaacaaagccggtcagcgatggcggtctt
ggcttcaacttcaagtggaacatgggctggatgaacgatatgctcaaatatatgagctat
gaccccatagacagagcattccatcacgatatgctgaccttctcgttcttctacgcattt
tcggagaatttcgtactgcctatatcccatgatgaagtagtacacggaaaagcttcgctg
gtaaacaagatgtacggcggagatgttgataaaaagtttgagcagtgcaagctgttcaat
gcatatatgatggctcaccccggcaagaagcttatgttcatgggcacagagttcgcccag
ttcagggagtgggactacgagaacggtcttgaatggttccttgtagaagaatacgagaac
caccgcaactaccacgcgttctcaaaacggctgaaccgcttctatctcgaccatcctcag
ttctggcagaaagacttcgactggtcgggattcagctggatagcaaatgacgatttcaga
cagagtataatcatattccgcagatttgatgcggaggcgaacgaggtcatagtgctttgc
aactttgtccccgttgagagaaagagctactgcttcggagtgccttacaaaggcaagtat
accgaagtattcaactccgcttctcctgacggcgcacctatgaccaacggcactgtaaag
tcacaggatgtgcccatgcacggctttgaacagtcggtatgtatagatataccgcctttc
tcctgtatgtactttgaagtgaaaaaggacagcgaaaagaaaaaagctactatcaaaaag
gcagagcacaaaaagaattccgacaagaaaaagaccgcaaaagaagcagaataa

DBGET integrated database retrieval system