KEGG   Ruminococcus albus: Rumal_0431Help
Entry
Rumal_0431        CDS       T01387                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ral  Ruminococcus albus
Pathway
ral00010  Glycolysis / Gluconeogenesis
ral00030  Pentose phosphate pathway
ral00051  Fructose and mannose metabolism
ral00052  Galactose metabolism
ral00680  Methane metabolism
ral01100  Metabolic pathways
ral01110  Biosynthesis of secondary metabolites
ral01120  Microbial metabolism in diverse environments
ral01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rumal_0431
   00030 Pentose phosphate pathway
    Rumal_0431
   00051 Fructose and mannose metabolism
    Rumal_0431
   00052 Galactose metabolism
    Rumal_0431
  Energy metabolism
   00680 Methane metabolism
    Rumal_0431
Enzymes [BR:ral01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Rumal_0431
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Rumal_0431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ADU20986
JGI: Rumal_0431
UniProt: E6UFA0
Position
471749..472951
Genome map
AA seq 400 aa AA seqDB search
MNIAVAQSGGPTCAINASLLGVFKEALKTPGIDAVFGSINGIEGMIKDELIDLKMVIRSN
EDMELLRQTPSTVLGSCRYKLPAADADDEVYRKIQTNLEKHRIEAFFYIGGNDSMDTVDK
LSAFLRSAGSDIRVIGIPKTIDNDLPVTDHTPGFGSAAKYVAATVQEIIRDSSVYSVDSV
TIIEVMGRHAGWLTASTCVLRANDEIAPHLIYLPECDLDADKFLEDVRIMQAKHKAVIVA
VSEGVRIPEENRKDIVVDNFGHEYLSGIGKTLEQLVKERIGCKVRSIELNVMQRCSSHIC
SKTDIDEAELIGSEGVKRALAGETGKMVYFKRLSDVPYVITVETTDASQVANKEKFFPKK
WVNHARNDVMPEAVKYFLPLIQGEVKIAMKNGMPVHFKLK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgcagttgctcagtcgggcggaccgacctgtgcgatcaacgcttctttgcta
ggggtattcaaggaagcactgaaaactcccgggatagacgcagttttcggttctatcaac
ggtatcgagggcatgatcaaggacgaactcattgatcttaaaatggtgataagatccaat
gaggatatggagcttttaaggcagactccatcgacggtgctcggttcatgccgctacaag
ctgcctgcggctgacgcagacgatgaggtgtaccgcaagatacagacaaatcttgaaaaa
catcgtatcgaagcttttttctatatcggcggaaatgattccatggatacagtggataag
ctttctgcttttctgaggtctgcgggttcggatatcagggtgataggtatacctaagacc
atcgacaacgatcttcccgttaccgatcatactccgggattcggctcggctgcgaaatat
gtggcagccaccgttcaggagataatcagggacagttctgtatactcggtggattctgtt
accattattgaagtaatgggcagacacgcaggctggctgacagcttccacctgtgttctc
agggctaacgatgagattgctcctcaccttatatatctgcccgaatgcgatcttgatgct
gacaagttccttgaagatgtacgcataatgcaggcaaagcacaaggcagtaatagttgca
gtatccgagggtgttcgcatacccgaggagaacaggaaggatatcgttgttgataacttc
ggtcacgaatacctttcgggcatcggcaagactctggagcagctggtaaaggaaaggata
ggctgcaaggtacgttctatcgaacttaatgttatgcagagatgttcatcgcatatatgc
tcaaagaccgatatcgacgaagctgagcttatcggcagtgagggtgttaaacgcgcactt
gccggagaaacaggcaagatggtatacttcaagcgcctgagcgatgtaccctatgttatt
accgttgaaactacagatgcttcgcaggtagctaacaaggagaagttctttccgaagaag
tgggtaaatcatgcacgaaatgatgttatgcccgaggctgtaaagtatttcctgccgctg
atacagggcgaggtaaagatcgccatgaagaacggtatgcctgttcatttcaaacttaaa
taa

DBGET integrated database retrieval system