KEGG   Ruminococcus albus: Rumal_0431Help
Entry
Rumal_0431        CDS       T01387                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ral  Ruminococcus albus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rumal_0431
   01230 Biosynthesis of amino acids
    Rumal_0431
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rumal_0431
   00030 Pentose phosphate pathway
    Rumal_0431
   00051 Fructose and mannose metabolism
    Rumal_0431
   00052 Galactose metabolism
    Rumal_0431
  Energy metabolism
   00680 Methane metabolism
    Rumal_0431
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Rumal_0431
Enzymes [BR:ral01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Rumal_0431
Protein phosphatases and associated proteins [BR:ral01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Rumal_0431
Messenger RNA biogenesis [BR:ral03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Rumal_0431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
471749..472951
Genome map
AA seq 400 aa AA seqDB search
MNIAVAQSGGPTCAINASLLGVFKEALKTPGIDAVFGSINGIEGMIKDELIDLKMVIRSN
EDMELLRQTPSTVLGSCRYKLPAADADDEVYRKIQTNLEKHRIEAFFYIGGNDSMDTVDK
LSAFLRSAGSDIRVIGIPKTIDNDLPVTDHTPGFGSAAKYVAATVQEIIRDSSVYSVDSV
TIIEVMGRHAGWLTASTCVLRANDEIAPHLIYLPECDLDADKFLEDVRIMQAKHKAVIVA
VSEGVRIPEENRKDIVVDNFGHEYLSGIGKTLEQLVKERIGCKVRSIELNVMQRCSSHIC
SKTDIDEAELIGSEGVKRALAGETGKMVYFKRLSDVPYVITVETTDASQVANKEKFFPKK
WVNHARNDVMPEAVKYFLPLIQGEVKIAMKNGMPVHFKLK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgcagttgctcagtcgggcggaccgacctgtgcgatcaacgcttctttgcta
ggggtattcaaggaagcactgaaaactcccgggatagacgcagttttcggttctatcaac
ggtatcgagggcatgatcaaggacgaactcattgatcttaaaatggtgataagatccaat
gaggatatggagcttttaaggcagactccatcgacggtgctcggttcatgccgctacaag
ctgcctgcggctgacgcagacgatgaggtgtaccgcaagatacagacaaatcttgaaaaa
catcgtatcgaagcttttttctatatcggcggaaatgattccatggatacagtggataag
ctttctgcttttctgaggtctgcgggttcggatatcagggtgataggtatacctaagacc
atcgacaacgatcttcccgttaccgatcatactccgggattcggctcggctgcgaaatat
gtggcagccaccgttcaggagataatcagggacagttctgtatactcggtggattctgtt
accattattgaagtaatgggcagacacgcaggctggctgacagcttccacctgtgttctc
agggctaacgatgagattgctcctcaccttatatatctgcccgaatgcgatcttgatgct
gacaagttccttgaagatgtacgcataatgcaggcaaagcacaaggcagtaatagttgca
gtatccgagggtgttcgcatacccgaggagaacaggaaggatatcgttgttgataacttc
ggtcacgaatacctttcgggcatcggcaagactctggagcagctggtaaaggaaaggata
ggctgcaaggtacgttctatcgaacttaatgttatgcagagatgttcatcgcatatatgc
tcaaagaccgatatcgacgaagctgagcttatcggcagtgagggtgttaaacgcgcactt
gccggagaaacaggcaagatggtatacttcaagcgcctgagcgatgtaccctatgttatt
accgttgaaactacagatgcttcgcaggtagctaacaaggagaagttctttccgaagaag
tgggtaaatcatgcacgaaatgatgttatgcccgaggctgtaaagtatttcctgccgctg
atacagggcgaggtaaagatcgccatgaagaacggtatgcctgttcatttcaaacttaaa
taa

DBGET integrated database retrieval system