KEGG   Ruminococcus albus: Rumal_1008Help
Entry
Rumal_1008        CDS       T01387                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ral  Ruminococcus albus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ral00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ral00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ral00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1152121..1154226
Genome map
AA seq 701 aa AA seqDB search
MKRIQIFENGINVVFEITDRQEIRLLHFSALPFDESTMTSRTGNSGFSLVELQVSGIDRA
GERHGNKYIITAPGYRMKYKDLKDTNNAIGRKLEIICYDEETGLETVSHMQFYSGTSVVR
TWTDVNNCGTEKWTIEYVSSFSVTGIEKEGLLSQDEKMRIGICHNSWQRELQWQFYSLEQ
VGLGLSQPAGFQHSSKVLGVTNVGNWSAKEYIPMGYLENTETASAMMWQIEHNGSWHWEI
SDREGHLYLQLSGPSEIESHWSKELEPGESFRSVYCGVCAVKGGFDEAVAEMTRYRRLIR
RKNRDNMRLPVIFNDYMNCLWADPTTEKELPLIDAAAEMGCEYFCIDAGWYADGVWWDWV
GEWQESRKRFPNGLREVTDYIRKKGMIPGVWLEIEVMGIKCPMADELPDEWFFVRHGKRV
FDRSRYQLDFRVPAVRKHCDEVIDRLVHEYGVGYIKMDYNIEPGIGTENCSDSFGDGLLE
HERAYLAWLDGVFERHPKLIIENCSSGGLRMDYALLSRCSIQSTSDQDDYRRYATIAANA
PTAVCPEQAAVWSYPLTSGDKEEVVFNMVNAMLLRVHQSGHLANLDPERKALVKEALDVY
KTIRDDIASAVPFYPLGTSSFSDNWTVLGLRTDDRIYLAVWRREGTQNCIIPVGDVFDDA
EARCIYPLFNEEKFAYDTIKGTLSVCFDNAYTARLFVLEKK
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatacagatatttgaaaacggtataaacgttgtatttgaaataaccgacagg
caggagatcaggctgttacacttttcggcactgccgtttgatgaaagcacaatgacttca
agaaccggcaattcgggattcagccttgttgaactgcaggtgagcggtatagacagggca
ggagaacgtcatggcaataagtatatcattacggcacccggatatcgcatgaaatataag
gatcttaaagacacgaataatgcgatcggacgtaagcttgaaataatatgttatgatgaa
gaaacgggtcttgaaactgtatcacatatgcagttctattcgggtacatccgttgtaagg
acatggaccgatgtcaacaattgcggtactgaaaaatggacaattgaatatgtatcgtca
ttttccgtgacgggtattgaaaaggaagggctgctgtcacaggacgagaagatgcggata
ggcatctgccataactcatggcagagagagcttcagtggcagttctacagccttgaacag
gtaggactcgggctgtcgcagcctgctggttttcagcattcttccaaggtgcttggtgtg
acaaatgttggtaactggtcggctaaggagtatatccccatggggtatcttgaaaacact
gaaaccgcatcagcgatgatgtggcagatagagcataacggctcgtggcactgggagatc
tctgaccgagagggacatttgtatctgcagctttcgggaccatcggagatagaatcacat
tggtctaaggaactggagcccggagaaagtttcagatctgtatactgcggagtatgtgca
gtaaaaggcggttttgatgaagctgtagcagaaatgacgaggtacaggcggcttataaga
cgcaaaaaccgcgataatatgcggctgcctgtaatattcaatgattatatgaactgtctt
tgggctgaccccactacagaaaaagaactgccgctgatagatgctgcggctgaaatggga
tgcgaatatttttgcattgatgcaggctggtatgcagacggtgtatggtgggactgggtc
ggtgaatggcaggaaagcaggaaaagattcccgaatggtctgcgtgaggtcactgactat
atccgcaaaaaaggtatgatacccggtgtgtggcttgagatcgaagttatgggtataaaa
tgccctatggcagatgaacttcctgatgaatggttttttgtaagacacggaaaaagggtg
ttcgacagaagcagataccaactggatttccgcgtacctgcggtgcgtaagcactgtgat
gaggtgatagacagactggtgcacgaatacggtgtagggtacataaaaatggactataat
atcgagccgggcataggtacggaaaactgttccgacagcttcggtgatggtctgttggag
catgagagagcctatttagcgtggcttgacggcgtttttgaacgtcacccgaagcttatt
atcgaaaattgctccagcggtggtctgaggatggactatgctttgctttcacgatgctcg
atacagtccacttcggatcaggatgattatcggagatatgcgactattgctgctaacgct
cctacggcggtgtgtccggaacaggctgccgtgtggtcttacccgcttacttcgggtgac
aaagaagaggtcgtattcaatatggtgaatgcgatgcttttacgtgtccatcaaagcgga
caccttgcaaatcttgatcctgaacgaaaggctcttgtcaaagaggcgcttgatgtttat
aaaactataagggacgatattgcgtcggctgtacctttctatccattgggaacatcaagc
ttttctgataactggacagttcttggtctgcgtactgatgacaggatatatcttgcggta
tggcgcagggaagggacgcagaactgtatcattcccgtcggtgatgtttttgatgatgca
gaggcaaggtgcatatatcctttatttaacgaggaaaaatttgcttatgatacaataaaa
gggactctttctgtgtgctttgataatgcttacactgcacgcctttttgtattggaaaag
aagtaa

DBGET integrated database retrieval system