KEGG   Ruminococcus albus: Rumal_1008Help
Entry
Rumal_1008        CDS       T01387                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ral  Ruminococcus albus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Rumal_1008
  Lipid metabolism
   00561 Glycerolipid metabolism
    Rumal_1008
   00600 Sphingolipid metabolism
    Rumal_1008
Enzymes [BR:ral01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Rumal_1008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1152121..1154226
Genome map
AA seq 701 aa AA seqDB search
MKRIQIFENGINVVFEITDRQEIRLLHFSALPFDESTMTSRTGNSGFSLVELQVSGIDRA
GERHGNKYIITAPGYRMKYKDLKDTNNAIGRKLEIICYDEETGLETVSHMQFYSGTSVVR
TWTDVNNCGTEKWTIEYVSSFSVTGIEKEGLLSQDEKMRIGICHNSWQRELQWQFYSLEQ
VGLGLSQPAGFQHSSKVLGVTNVGNWSAKEYIPMGYLENTETASAMMWQIEHNGSWHWEI
SDREGHLYLQLSGPSEIESHWSKELEPGESFRSVYCGVCAVKGGFDEAVAEMTRYRRLIR
RKNRDNMRLPVIFNDYMNCLWADPTTEKELPLIDAAAEMGCEYFCIDAGWYADGVWWDWV
GEWQESRKRFPNGLREVTDYIRKKGMIPGVWLEIEVMGIKCPMADELPDEWFFVRHGKRV
FDRSRYQLDFRVPAVRKHCDEVIDRLVHEYGVGYIKMDYNIEPGIGTENCSDSFGDGLLE
HERAYLAWLDGVFERHPKLIIENCSSGGLRMDYALLSRCSIQSTSDQDDYRRYATIAANA
PTAVCPEQAAVWSYPLTSGDKEEVVFNMVNAMLLRVHQSGHLANLDPERKALVKEALDVY
KTIRDDIASAVPFYPLGTSSFSDNWTVLGLRTDDRIYLAVWRREGTQNCIIPVGDVFDDA
EARCIYPLFNEEKFAYDTIKGTLSVCFDNAYTARLFVLEKK
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatacagatatttgaaaacggtataaacgttgtatttgaaataaccgacagg
caggagatcaggctgttacacttttcggcactgccgtttgatgaaagcacaatgacttca
agaaccggcaattcgggattcagccttgttgaactgcaggtgagcggtatagacagggca
ggagaacgtcatggcaataagtatatcattacggcacccggatatcgcatgaaatataag
gatcttaaagacacgaataatgcgatcggacgtaagcttgaaataatatgttatgatgaa
gaaacgggtcttgaaactgtatcacatatgcagttctattcgggtacatccgttgtaagg
acatggaccgatgtcaacaattgcggtactgaaaaatggacaattgaatatgtatcgtca
ttttccgtgacgggtattgaaaaggaagggctgctgtcacaggacgagaagatgcggata
ggcatctgccataactcatggcagagagagcttcagtggcagttctacagccttgaacag
gtaggactcgggctgtcgcagcctgctggttttcagcattcttccaaggtgcttggtgtg
acaaatgttggtaactggtcggctaaggagtatatccccatggggtatcttgaaaacact
gaaaccgcatcagcgatgatgtggcagatagagcataacggctcgtggcactgggagatc
tctgaccgagagggacatttgtatctgcagctttcgggaccatcggagatagaatcacat
tggtctaaggaactggagcccggagaaagtttcagatctgtatactgcggagtatgtgca
gtaaaaggcggttttgatgaagctgtagcagaaatgacgaggtacaggcggcttataaga
cgcaaaaaccgcgataatatgcggctgcctgtaatattcaatgattatatgaactgtctt
tgggctgaccccactacagaaaaagaactgccgctgatagatgctgcggctgaaatggga
tgcgaatatttttgcattgatgcaggctggtatgcagacggtgtatggtgggactgggtc
ggtgaatggcaggaaagcaggaaaagattcccgaatggtctgcgtgaggtcactgactat
atccgcaaaaaaggtatgatacccggtgtgtggcttgagatcgaagttatgggtataaaa
tgccctatggcagatgaacttcctgatgaatggttttttgtaagacacggaaaaagggtg
ttcgacagaagcagataccaactggatttccgcgtacctgcggtgcgtaagcactgtgat
gaggtgatagacagactggtgcacgaatacggtgtagggtacataaaaatggactataat
atcgagccgggcataggtacggaaaactgttccgacagcttcggtgatggtctgttggag
catgagagagcctatttagcgtggcttgacggcgtttttgaacgtcacccgaagcttatt
atcgaaaattgctccagcggtggtctgaggatggactatgctttgctttcacgatgctcg
atacagtccacttcggatcaggatgattatcggagatatgcgactattgctgctaacgct
cctacggcggtgtgtccggaacaggctgccgtgtggtcttacccgcttacttcgggtgac
aaagaagaggtcgtattcaatatggtgaatgcgatgcttttacgtgtccatcaaagcgga
caccttgcaaatcttgatcctgaacgaaaggctcttgtcaaagaggcgcttgatgtttat
aaaactataagggacgatattgcgtcggctgtacctttctatccattgggaacatcaagc
ttttctgataactggacagttcttggtctgcgtactgatgacaggatatatcttgcggta
tggcgcagggaagggacgcagaactgtatcattcccgtcggtgatgtttttgatgatgca
gaggcaaggtgcatatatcctttatttaacgaggaaaaatttgcttatgatacaataaaa
gggactctttctgtgtgctttgataatgcttacactgcacgcctttttgtattggaaaag
aagtaa

DBGET integrated database retrieval system