KEGG   Ruminococcus albus: Rumal_1091Help
Entry
Rumal_1091        CDS       T01387                                 

Definition
type III site-specific deoxyribonuclease (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
ral  Ruminococcus albus
Brite
Enzymes [BR:ral01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Rumal_1091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1268167..1271277
Genome map
AA seq 1036 aa AA seqDB search
MADMKFKFTIQPYQTEAVESVVNVFAGQSFNDRFTYRRDVEVERTLLNAQKSDEELYMGF
ANARVQLDGTQLLANIRKIQGRNNIKLSDSLTTKLGCCSLDVEMETGTGKTYVYIKTMFE
LNKRYGWSKFIVVVPSIAIREGVRKSFDVMQEHFHEQYGKKARFFVYDSKNLSEIDDFSQ
SADIHVMIINTQAFNSSFNEAKNVEGRKGDAAARIIFSKRDDFSSRRPIDVIAANNPIII
MDEPQKMGGDKTQAALKQFKPLFVLNYSATHKQHHELVYVLDALDAYNKHLVKRIEVKGF
DIKNLRGTDSYLYLSSIIISPKKPPMARIEFEIGYDKSINRETRLLGVDDDLYSLSKNMN
QYRGYRISEIDPVRGIVTFTNGEIIHSGEVQGDVSESDLRRVQIRETIRSHFEKEKELFD
KGIKCLSLFFIDEVAKYRCYDEDGNEVNSEYGEIFEQEYTDILNEYLTLFDTPYEKYLRS
IEVHQTHAGYFSIDKKGRKIDSSLKRGTDESDDISAYDLILKDKERLLSFNTPVRFIFSH
SALREGWDNPNVFQICTLKHGGSSPTQKRQEVGRGLRLCVNQNGDRMDSDTLGDLVQQIN
QLTVIASDGYSEFVADLQRGIREDLYDRPTKASAEYFTGKTLVLNGQDITITEKQGKDIY
RYLIKNDYIDDEDHITDQYLTDLANRVLASLPESCIEITEGVHALVQSIYDEHALDDMIR
NGNSTTIQENALNDNFYKKEFQTLWNYINHKYAYTVEFDSEELIKKAIAYLDEKMFVAKL
QYTVTTGKQEDKLNNETIKTGAGFSTEKSKTYTLDRTEGSSIPYDLIGEIAAGVKLTRRS
TARILAGIKPTTYAYYCNNPEEFISKAIRLILEQKATMIVEHISYNQTDGTYDSAIFTAE
KNNDFSKAYRAQKHIQDYVFTDGYAKDGQSVERKFVEDIDKADEVCVYAKLPKGFSIPTP
VGNYSPDWAIAFHVGMVKHIFFIAETKGTMESLNLKRIEQAKIDCAKKLFAQLSKADVVY
HEVDNYQHLLDKINEL
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atggctgacatgaaattcaaatttaccatacagccctatcagacagaggctgtagaaagc
gtcgtgaacgtatttgcaggtcagtcttttaatgaccgtttcacatatcgcagagatgtg
gaagtagaacgcactcttctgaatgcacagaagtctgacgaagaattgtatatgggcttc
gcaaatgcccgtgtgcaacttgatgggactcagctccttgcaaatatccgaaaaatacag
ggcagaaacaatatcaagctgtccgattctctgacaaccaagctcggctgctgttctctt
gacgtagaaatggaaacaggaactggaaagacctatgtttacatcaaaacgatgtttgaa
ctgaacaagcgttacggctggagcaaattcattgtcgttgtaccgagcattgcaatccgc
gagggagtccgcaagagctttgacgtaatgcaggagcatttccatgagcaatacggcaaa
aaggcgcggttcttcgtttacgattccaaaaacctttccgagatcgacgatttcagccaa
agtgcagatattcatgtaatgatcatcaacacgcaggcgttcaattcttcgtttaatgag
gcaaagaatgtcgagggacgcaagggagatgccgctgcaagaatcatattctccaagcgt
gatgattttagttctcgcagacctattgatgtgattgctgcgaataaccccattatcatt
atggacgaacctcaaaaaatgggcggtgacaaaacgcaggctgcactgaaacagttcaag
ccgttgtttgttttgaattattctgccacccataaacagcaccatgagcttgtctatgtg
ctggatgcactcgatgcctataataagcatttggttaagcgtattgaagttaagggcttt
gatattaaaaatctgcgtggtactgacagttatctgtacctgtcaagtatcatcatttct
ccgaaaaagcccccgatggctcgtattgaatttgaaataggctatgataaatccattaac
agagaaactcgtttgctgggtgtggacgatgatctgtattccctctcaaaaaatatgaat
caataccgtggatatcgtatcagcgagattgatcctgtccgaggtattgtgacttttaca
aacggtgagatcattcattcaggtgaagtgcagggtgatgtttcggaatctgatttacgg
cgtgttcagatcagagaaacgatacgctctcattttgaaaaggaaaaagagctttttgat
aagggcattaaatgcctgtctttgttcttcatagatgaggtagcaaagtaccgctgttat
gatgaagacggcaatgaggtcaattctgaatatggtgagatttttgagcaggaatatacc
gacatactgaatgaatatctcacgctgtttgatacgccatatgagaagtatcttcgttct
attgaagttcatcagactcatgccggatatttcagtattgataaaaagggacgtaagata
gatagctctctcaagcgcggcactgatgaaagtgatgatatttctgcatatgatcttatc
ttgaaggataaggaacggttactctcgttcaatacgcctgttcgttttattttctcacat
tccgctctccgtgaaggttgggataacccgaacgtttttcagatttgtacgctgaagcat
ggcggtagttctcctacgcaaaagcgtcaggaagtcggcagaggtctacgcctctgcgtt
aatcaaaacggtgaccgaatggacagcgatacacttggggatcttgtgcagcagatcaat
caactgacagttatcgcatctgacggttacagcgaatttgttgctgatttgcagcgaggt
atccgtgaagatctgtatgatcgcccgacaaaggcatccgcagagtatttcaccggaaag
acacttgttttgaacggacaggatattacaattaccgaaaaacaaggaaaggatatctat
cgctatcttatcaaaaatgattatattgacgatgaagatcatatcaccgatcaatatctt
actgatcttgccaatagagttcttgcatcgttgccggaaagctgtattgaaatcactgaa
ggggttcatgctcttgtgcaaagcatctatgatgaacacgcccttgatgacatgattcgc
aatggtaacagtacaacaattcaggagaacgcactgaatgataatttctataaaaaggaa
tttcaaacactctggaattatatcaaccataagtatgcctacactgtcgaattcgacagc
gaggaattgattaaaaaggctattgcttaccttgacgaaaaaatgtttgttgctaaactt
caatatacagtaacaacaggtaaacaggaagataaactcaataatgaaacgataaaaact
ggcgcaggcttctctactgaaaaaagtaagacctatacattagatagaactgaaggcagt
tctatcccctatgatcttattggagaaattgcagccggtgtaaaacttactcgacgttca
acagcaagaattctggctggtataaagcctactacatatgcgtattattgtaataatcca
gaagagtttatttcaaaggcaattcgtttgattttagagcagaaagcaacgatgattgta
gagcatatttcttataatcaaactgatggaacatatgatagtgctatattcactgctgaa
aaaaataatgatttttctaaggcgtatagagcgcaaaagcatattcaggattatgttttt
acagacggatatgctaaagacggtcaaagcgttgaacgaaaatttgtcgaagacattgat
aaagctgatgaagtttgtgtttacgcaaaacttccaaagggcttttctattcctacacct
gttggaaactattctcctgactgggcaattgcattccatgtaggtatggtgaaacatatt
ttctttattgctgaaaccaagggtactatggaatcactgaatctaaaacgcatagagcaa
gctaaaattgattgtgcaaaaaagcttttcgctcagctgtcaaaagcagatgttgtatat
catgaagttgataattatcagcatctacttgataaaataaatgaactataa

DBGET integrated database retrieval system