KEGG   Ruminococcus albus: Rumal_1280Help
Entry
Rumal_1280        CDS       T01387                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ral  Ruminococcus albus
Pathway
ral00010  Glycolysis / Gluconeogenesis
ral00620  Pyruvate metabolism
ral00640  Propanoate metabolism
ral00680  Methane metabolism
ral01100  Metabolic pathways
ral01110  Biosynthesis of secondary metabolites
ral01120  Microbial metabolism in diverse environments
ral01130  Biosynthesis of antibiotics
ral01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rumal_1280
   00620 Pyruvate metabolism
    Rumal_1280
   00640 Propanoate metabolism
    Rumal_1280
  Energy metabolism
   00680 Methane metabolism
    Rumal_1280
Enzymes [BR:ral01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Rumal_1280
Lipid biosynthesis proteins [BR:ral01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Rumal_1280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Flavodoxin_3
Motif
Other DBs
NCBI-ProteinID: ADU21796
JGI: Rumal_1280
UniProt: E6UEM7
Position
1473419..1475101
Genome map
AA seq 560 aa AA seqDB search
MSGMNDFYKQFVDEEVDENGTLKKFELKLKDDFNFGYDVIDELARLYPEKKMLHWINDHG
GEREFTYAEMSRLSNQCANMMLAHGVKKGDMLLAVLKRHYEFWILAYGLIKIGCILIPAT
SQLMPKDYVYRFKAANVKYVCATYFDEVADRIDTACKKYTGIKEKFICRGKKEGWTDFME
ELSKYPDTLEKQDINKNDYMLAYFSSGTTGQPKMAIHANAYAAGSITTAKYWHHVDETSV
HLTVSESGWAKCAWGKMFGQLICGAEEFIYDMDRFHPDKMLTVLQDYNISSFCAPPTMYR
FFIKEGLGNYDLSGIKYSCIAGEALNAEVFNRWKEYTGLELMEGFGQTESVVIVANFYGM
KPKPGSMGKPSPLYDVDIIRKDGTSCDTGETGEIIIRAERGKHPALFKEYYGNKELTDNA
WRGGIYHTGDTAYRDEDGYFWYVGRTDDLIKASGYRIGPFEIESILMEHPAVREVAVTAA
DDEIRGKVVKATIVLSNGYTGSPELVKELQTYVKKSTAPYKYPRIIEFVDDLPKTESGKI
RRVEIRDNDHRKYEESHSSK
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtatgaatgatttttataagcagttcgtcgatgaggaagtcgatgagaacggc
acactgaaaaagttcgagctgaagctgaaggacgatttcaatttcggctacgatgtaata
gatgaactggcaaggctctatcccgaaaagaaaatgctccactggataaatgaccacggc
ggcgaaagagagttcacctatgccgaaatgagcagactttcaaatcagtgcgcaaatatg
atgctggctcacggtgtcaaaaaaggcgatatgctgctggcagtcctgaaaagacactat
gagttctggatactggcttacggtcttataaagataggatgtatacttatccccgccacc
tcccagctcatgcccaaggactacgtataccgcttcaaagcagcaaatgtaaagtatgta
tgcgcgacttattttgatgaagtcgcagaccgtatagataccgcctgcaagaagtataca
ggcataaaggagaagttcatctgccgcggtaagaaagagggctggactgacttcatggag
gaactgtccaaatatcccgacactcttgaaaagcaggacatcaataaaaatgactatatg
ctggcatatttcagctcaggcacaacaggtcagcccaaaatggctatccacgccaatgcc
tatgccgcaggctccataactaccgcaaagtactggcaccacgtcgatgaaacttccgta
cacctgacagtttccgaatccggctgggcgaaatgtgcatggggcaaaatgttcggtcag
cttatatgcggtgccgaggaatttatatatgatatggacagattccaccccgataagatg
ctgacggtcctccaggattacaatatctcttccttctgtgcacctcctaccatgtacagg
ttctttataaaggaaggtcttggaaactatgacctttcgggtataaagtacagctgtatc
gcaggcgaggctctcaatgcagaggtattcaaccgctggaaggagtatacaggtcttgaa
cttatggaaggcttcggtcagaccgagagcgttgtaatagtagcgaatttctacggcatg
aagccaaagcccggttcaatgggcaagccatcccccctctatgatgttgatatcatccgc
aaggacggcaccagctgcgatacaggcgaaacaggcgaaataatcatcagggctgaacgc
ggcaagcatcccgcactcttcaaggaatactacggcaacaaggaacttaccgacaacgca
tggcgcggcggcatctaccatacaggcgataccgcttaccgcgacgaggacggctatttc
tggtatgtgggacgtaccgatgaccttatcaaggcatccggctaccgtataggacccttc
gagatagaaagcatacttatggagcatcccgctgtcagggaggtagctgtcacagccgcc
gatgatgagatacgcggcaaggtggtaaaggcgactatcgtcctttccaacggctataca
ggctctcccgagcttgttaaggaactccagacttatgttaagaagtccacagcaccctat
aagtatccccgtatcatcgaattcgtagatgatcttcccaagaccgaaagcggcaagatc
cgccgtgttgagatcagggacaacgatcacagaaagtatgaggaaagtcattcatctaaa
taa

DBGET integrated database retrieval system