KEGG   Ruminococcus albus: Rumal_1286Help
Entry
Rumal_1286        CDS       T01387                                 

Definition
dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ral  Ruminococcus albus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ral01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ral00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1478946..1480247
Genome map
AA seq 433 aa AA seqDB search
MDKTQLAAAFAEYFDKHMDEILSDLGEIIAIESIADENSDVRPFGEGSAKALAWGEAKLK
SLGMTTKNFDNYAVRGDFNTDGEPVLGILAHLDTVPVSSNWSYSPFELTRKDGVLYGRGT
IDDKGPATAVLWAVKAIRDMGLPMKNFRVIFGGNEENGCTDMEYYESCEKFPPMVFTPDG
SFPVLNCEKGMVHMTFSAPFKDSEIVSVDAGMAINAIPDRCTVAYKDGTSSVTEGHSAHG
SRPENGDNAVTKFLSGYVGNNALLLGLKKLFPHGEFDGTTCGLGFEDSVSGKMTCALTVL
KTKEDRLCGGIDIRFPIDRSYDEISTIIKDAVCGIGFEIDTCEGMEPHYVDENSDFVQAL
LRVYERVKGEKGSCIAEGGITYVHNTPGAVAFGAEFPWENNNMHGDDEHISMDTFRLNLN
MYANAITELCLID
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggataagacacagcttgccgcagcttttgcggaatactttgataaacacatggatgag
atcctttccgacctcggagagataatcgccatagagagtatagcagacgaaaactcggat
gtacgtcccttcggtgaaggctctgcaaaggcgctggcatggggcgaggctaagctgaag
tccctgggtatgacgactaagaattttgataactacgctgtcaggggcgatttcaacacc
gacggcgaaccggtgctgggcatactggcacatctggataccgtacccgtcagcagcaac
tggagctattctccctttgaactcacccgtaaggacggcgtactctatggcaggggcacg
atagacgacaaaggccctgctaccgcagttttatgggctgtaaaggcgatacgcgatatg
ggtctgcccatgaagaatttccgcgtgatattcggcggcaacgaggaaaacggctgtact
gatatggaatactacgaaagctgtgaaaagttcccgcctatggtattcactcccgacggc
tcattccccgtactcaactgtgaaaagggcatggtccacatgacattctccgcacctttt
aaagacagcgagatagtatccgttgatgcaggtatggctataaacgctatccccgacaga
tgcaccgttgcttataaagacggtacttcatctgtcaccgagggtcattccgcccacggc
tcacgccccgaaaacggcgataatgcagttacaaaattcctctcgggctatgtgggaaat
aacgcgctcctgctgggtcttaaaaagctgttcccccacggcgaatttgacggcactacc
tgcggactgggctttgaagacagcgtatcaggcaagatgacctgcgctctcactgtcctt
aaaaccaaggaagacagactttgcggcggtattgatatccgtttccccattgaccgttcc
tatgacgagataagcactatcatcaaagatgcagtctgcggtatcggcttcgagatagat
acctgcgagggcatggaaccccactacgtcgatgaaaacagcgatttcgttcaggcactc
ctcagagtttacgaaagagtaaaaggcgaaaaaggctcctgtatcgcagagggcggtata
acctatgtccataatacccccggcgccgtagccttcggtgcagagttcccctgggagaat
aataatatgcacggcgatgatgaacatatctccatggatactttcagactaaacctgaat
atgtacgccaacgccatcaccgaactctgcctcatcgactga

DBGET integrated database retrieval system