KEGG   Ruminococcus albus: Rumal_1286Help
Entry
Rumal_1286        CDS       T01387                                 

Definition
(GenBank) dipeptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ral  Ruminococcus albus
Pathway
ral00300  Lysine biosynthesis
ral01100  Metabolic pathways
ral01120  Microbial metabolism in diverse environments
ral01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Rumal_1286
Enzymes [BR:ral01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Rumal_1286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer L27
Motif
Other DBs
NCBI-ProteinID: ADU21801
JGI: Rumal_1286
UniProt: E6UEN2
Position
1478946..1480247
Genome map
AA seq 433 aa AA seqDB search
MDKTQLAAAFAEYFDKHMDEILSDLGEIIAIESIADENSDVRPFGEGSAKALAWGEAKLK
SLGMTTKNFDNYAVRGDFNTDGEPVLGILAHLDTVPVSSNWSYSPFELTRKDGVLYGRGT
IDDKGPATAVLWAVKAIRDMGLPMKNFRVIFGGNEENGCTDMEYYESCEKFPPMVFTPDG
SFPVLNCEKGMVHMTFSAPFKDSEIVSVDAGMAINAIPDRCTVAYKDGTSSVTEGHSAHG
SRPENGDNAVTKFLSGYVGNNALLLGLKKLFPHGEFDGTTCGLGFEDSVSGKMTCALTVL
KTKEDRLCGGIDIRFPIDRSYDEISTIIKDAVCGIGFEIDTCEGMEPHYVDENSDFVQAL
LRVYERVKGEKGSCIAEGGITYVHNTPGAVAFGAEFPWENNNMHGDDEHISMDTFRLNLN
MYANAITELCLID
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggataagacacagcttgccgcagcttttgcggaatactttgataaacacatggatgag
atcctttccgacctcggagagataatcgccatagagagtatagcagacgaaaactcggat
gtacgtcccttcggtgaaggctctgcaaaggcgctggcatggggcgaggctaagctgaag
tccctgggtatgacgactaagaattttgataactacgctgtcaggggcgatttcaacacc
gacggcgaaccggtgctgggcatactggcacatctggataccgtacccgtcagcagcaac
tggagctattctccctttgaactcacccgtaaggacggcgtactctatggcaggggcacg
atagacgacaaaggccctgctaccgcagttttatgggctgtaaaggcgatacgcgatatg
ggtctgcccatgaagaatttccgcgtgatattcggcggcaacgaggaaaacggctgtact
gatatggaatactacgaaagctgtgaaaagttcccgcctatggtattcactcccgacggc
tcattccccgtactcaactgtgaaaagggcatggtccacatgacattctccgcacctttt
aaagacagcgagatagtatccgttgatgcaggtatggctataaacgctatccccgacaga
tgcaccgttgcttataaagacggtacttcatctgtcaccgagggtcattccgcccacggc
tcacgccccgaaaacggcgataatgcagttacaaaattcctctcgggctatgtgggaaat
aacgcgctcctgctgggtcttaaaaagctgttcccccacggcgaatttgacggcactacc
tgcggactgggctttgaagacagcgtatcaggcaagatgacctgcgctctcactgtcctt
aaaaccaaggaagacagactttgcggcggtattgatatccgtttccccattgaccgttcc
tatgacgagataagcactatcatcaaagatgcagtctgcggtatcggcttcgagatagat
acctgcgagggcatggaaccccactacgtcgatgaaaacagcgatttcgttcaggcactc
ctcagagtttacgaaagagtaaaaggcgaaaaaggctcctgtatcgcagagggcggtata
acctatgtccataatacccccggcgccgtagccttcggtgcagagttcccctgggagaat
aataatatgcacggcgatgatgaacatatctccatggatactttcagactaaacctgaat
atgtacgccaacgccatcaccgaactctgcctcatcgactga

DBGET integrated database retrieval system