KEGG   Ruminococcus albus: Rumal_1371Help
Entry
Rumal_1371        CDS       T01387                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ral  Ruminococcus albus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1578695..1580641
Genome map
AA seq 648 aa AA seqDB search
MNGNLVKKLAAYALCLTMASSMIPGAAFTATAESASPAFSTDFEDGNVSMFSKRGDSDTS
VIKVVEDSAAPSGSKVMSVTGRSKSWNGPSIALEGILEPYVKYDITVKVKAQWYNTVCIS
MQHTPAGSDSPQYTNLAKAVSQGDYVELSASFSYGSDEKDVSLYIETTGDANDLYIDDLT
ICESPNNLDLTAPSLKNVYGDMFKFGTATTVSELAPKSTKALIKKHFNSLTAGNELKPDS
VLDQQACLALAASGDDENPQVTLDAAKPILDFARDNNIPMRGHVLVWHQQTPIWFFKENY
DANGEWVSKEKMLRRMENYIKNVFTAVKKEYPDVDFYAWDVVNECFTDAGAPRNPGVPDS
SNGYQSSPWVQIFGDNSFIKPAFIYAKKYAPSGCKLYYNDYNEYMQKSDAIVKLCQDINS
SGHYIDGIGMQSHLNVTNNGGSDPFPSVSMYRQALDKFSKTGLDIQITELDATVNNKRFD
LQAKYYSDIMDAIVDYKDYVSAVVVWGTTDDLSWRADRDPLLFNQDYSVKPCFESIVDGI
EYTETENENENDPDPVDTYPTNVKANYSTKYHQIQFVWDKVKGADKYGIAVYLAGKWRVQ
TTNITNNSYVTPKNLTPGMTYKVAVAARVNGKWDTTNAIKNAITVTVQ
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaaatttagtaaaaaagctggctgcttatgcactttgcctgactatggcatct
tccatgataccgggtgctgcatttacagctacagctgaatcagcaagccctgctttctcg
actgatttcgaggacggaaacgtttcgatgttctcaaagcgcggtgacagcgatacttct
gttatcaaggtcgttgaggactccgctgcacccagcggcagcaaggtaatgtctgtaaca
ggcagaagcaagagctggaacggtccttcgatagcactggagggtatacttgaaccttac
gttaagtatgacatcaccgttaaggtaaaggcacagtggtataacactgtctgcatctcg
atgcagcatacgcccgcaggctcagactcgccccagtacactaacctcgcaaaagccgtt
tcacagggcgattatgttgagctgagcgccagcttctcctacggctcggacgaaaaagat
gtttcgctgtatattgaaacaacaggcgatgcaaacgatctgtacatagacgatcttacc
atatgtgagtcgcccaacaatcttgatctgactgcaccttcacttaaaaatgtttacggc
gatatgttcaaattcggcactgctaccactgtttccgaacttgcaccaaagtctacaaag
gcacttatcaaaaagcatttcaacagccttacagcaggcaacgagctgaagcctgacagc
gttctcgaccaacaggcttgcctagcactggcggcatcgggcgatgacgaaaacccgcag
gtaactcttgacgctgcaaagcccatactcgactttgcccgcgataacaatatccccatg
agaggtcacgtcctggtatggcaccagcagactcctatctggttcttcaaagaaaactat
gatgccaacggcgagtgggtatctaaggaaaagatgctcagacgtatggaaaactacatc
aagaacgttttcaccgcagtaaagaaagaatatcccgatgttgacttctatgcgtgggac
gttgtgaacgagtgcttcaccgatgcgggtgcgcccagaaatcccggcgttcctgattct
tccaacggttatcagtcatctccgtgggtgcagatcttcggtgacaactcattcatcaag
cctgcattcatatacgctaagaagtatgctccctcaggctgcaagctctactacaatgac
tataacgagtatatgcagaagagcgatgctatcgtaaaactgtgccaggatatcaattcc
agcggtcactacatcgacggcatcggtatgcagtcgcatctgaacgttaccaacaacggc
ggttctgatccgttcccgagcgtaagtatgtacagacaggcacttgacaagttcagcaag
accggtcttgatatacagatcacagagctggatgctactgtaaacaacaagaggttcgat
ctccaggctaagtactacagcgacatcatggatgctatagttgattacaaggactatgtt
tctgcggttgttgtttggggtactactgatgacctcagctggagagctgaccgtgatccg
ctgttgttcaaccaggattactcggtaaagccttgctttgagtctatcgttgacggtatc
gagtataccgaaactgaaaacgaaaatgaaaatgatcccgatcctgttgatacttatcct
acaaatgttaaggcaaattacagtacaaagtatcaccagatacagttcgtatgggacaag
gtcaagggcgctgacaagtacggtatcgctgtatatctggcaggcaagtggagagttcag
accactaacatcacaaataacagctatgtaactcccaagaacctgactcccggcatgacc
tataaggttgcagttgctgcaagagttaacggtaagtgggatactactaacgctatcaag
aacgctatcactgttactgttcagtaa

DBGET integrated database retrieval system