KEGG   Ruminococcus albus: Rumal_1631Help
Entry
Rumal_1631        CDS       T01387                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ral  Ruminococcus albus
Pathway
ral00010  Glycolysis / Gluconeogenesis
ral00030  Pentose phosphate pathway
ral00051  Fructose and mannose metabolism
ral00052  Galactose metabolism
ral00680  Methane metabolism
ral01100  Metabolic pathways
ral01110  Biosynthesis of secondary metabolites
ral01120  Microbial metabolism in diverse environments
ral01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rumal_1631
   00030 Pentose phosphate pathway
    Rumal_1631
   00051 Fructose and mannose metabolism
    Rumal_1631
   00052 Galactose metabolism
    Rumal_1631
  Energy metabolism
   00680 Methane metabolism
    Rumal_1631
Enzymes [BR:ral01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Rumal_1631
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Rumal_1631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ADU22131
JGI: Rumal_1631
UniProt: E6UHT2
Position
1881380..1882456
Genome map
AA seq 358 aa AA seqDB search
MKRRIGILTSGGDCPGLNATIRGVAKACYEKFGEDVEIIGIHDGYYGLINGLCKEMNQSD
FSGILTTGGTIFGTKRTPFKMMQVIEDDKVDKVKAMKATYKKQKLDCLLTLGGNGTHKTA
NLLSSEGLNVIGLPKTIDNDIWGTSVTFGFHTAVDTATDVIDRLHSTANSHGRILVAEIM
GNKAGWLTLYSGIAGGADMIVIPEIPYDIEKLAAACERRDSKGFSIMAVAEGAFDKEEAK
MKKKERAKLRAEQGITTATARIAKQIEEMTGRETRVCIPGHMLRGGSPSAYDRVLATKFG
VHAAELVAKEKYGYAVAMIKEVVSENKLEDVAGKTKFVPEDDQMVKYAKALGVSFGDK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaaggataggcatactcaccagcggcggagattgtcccggactcaacgctaca
atcagaggcgttgccaaagcgtgttatgaaaaattcggtgaggatgttgagataattggt
atacatgacggttactacgggcttataaacggtctgtgcaaggaaatgaatcagtctgat
ttctcgggaatactcactacgggcggcactatctttggtacaaagagaactccgttcaag
atgatgcaggtaattgaagatgataaggtcgataaggtaaaggctatgaaagccacttat
aaaaagcagaagctggattgcctgttaactcttggtggaaacggcacccataagaccgcc
aatctgctgtcaagtgagggacttaacgttatcggtctgcctaagacaatagataacgat
atctggggcaccagcgtaactttcggctttcatacagcagttgatacagcaacagatgta
atcgatagacttcactccaccgccaactcccacggccgtatacttgtggcagagataatg
ggcaacaaggcgggctggctgacactttattcgggtatagcaggcggtgctgatatgata
gttatccccgagataccctacgatatcgaaaagcttgctgcagcctgcgaacgccgtgat
tccaagggattttccattatggctgtagctgagggcgctttcgataaggaagaagccaag
atgaagaagaaggagagagctaaactccgtgctgaacagggcataaccactgccaccgca
cgtatcgccaagcagatagaggaaatgacaggcagagagaccagagtgtgtatacccggt
catatgctccgcggcggtagcccatcagcttacgacagagtactcgccacaaagttcggc
gtacacgcggctgaactcgtagccaaggaaaagtacggctacgcagtggctatgataaag
gaagtagtatccgagaataagcttgaagacgttgcaggcaaaacaaagttcgtccccgag
gacgaccagatggtaaaatacgccaaagcactgggcgtatcgtttggagataagtaa

DBGET integrated database retrieval system