KEGG   Ruminococcus albus: Rumal_1712Help
Entry
Rumal_1712        CDS       T01387                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ral  Ruminococcus albus
Pathway
ral00260  Glycine, serine and threonine metabolism
ral00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ral01100  Metabolic pathways
ral01110  Biosynthesis of secondary metabolites
ral01130  Biosynthesis of antibiotics
ral01230  Biosynthesis of amino acids
Module
ral_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rumal_1712
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rumal_1712
Enzymes [BR:ral01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rumal_1712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB BtpA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADU22211
JGI: Rumal_1712
UniProt: E6UIF0
Position
complement(1969538..1970335)
Genome map
AA seq 265 aa AA seqDB search
MKNRIDACFEDLKAQGKKALVTFITAGDPDLATTEKLVLEMFDKGSDIVEIGVPFSDPIA
EGGTIQRASLRSLKHNTNLDQIFELVSRLRDNTDKPILLMMYLNTVFRYGTEKFFNNCKN
VQIDGVIIPDMPFEERDEVKEYSEKTGVRSIYLVAPTSKERVKMIAEESKGFLYIVSSLG
VTGTRNEISTNFNELLAPLKEGNYCPACIGFGISNGEQAKKMASYCDGCIIGSAIVNIVE
KYGADSVEPVGEFVASVREALDSNS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataggatagatgcttgctttgaagacctcaaagctcagggtaaaaaggcactt
gtaactttcataacggcgggcgacccagaccttgccaccacagaaaagcttgtacttgaa
atgttcgataaaggcagtgatatcgttgagataggcgtacctttctccgatcccatagct
gagggcggcacgatccagcgtgcttcactgagatcgttgaaacacaacaccaacctcgac
cagatattcgaacttgtaagcaggctccgcgacaatacggacaagcccatactgcttatg
atgtacctgaacacagttttccgttacggtacagagaagttcttcaacaactgcaagaac
gttcagatagacggtgttatcatacccgatatgcctttcgaggagcgtgacgaagtcaag
gaatactccgaaaagacaggagtaagaagcatttatcttgtcgcacccacatcaaaagag
cgcgtaaagatgatagctgaggaaagcaagggcttcctttatatagtatcatctctggga
gtaaccggcacacgtaatgagataagtactaactttaacgagctgctggctcctctcaaa
gaaggcaattactgccctgcctgcataggttttggtatatccaacggcgaacaggcaaag
aaaatggcatcctactgtgacggctgtatcatcggttcggcgatagttaatatcgtggaa
aaatatggcgcagacagcgttgagcctgttggtgaatttgttgcaagcgtaagagaagcg
cttgactctaattcataa

DBGET integrated database retrieval system