KEGG   Ruminococcus albus: Rumal_1713Help
Entry
Rumal_1713        CDS       T01387                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ral  Ruminococcus albus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rumal_1713
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rumal_1713
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rumal_1713
Enzymes [BR:ral01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rumal_1713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1970325..1971515)
Genome map
AA seq 396 aa AA seqDB search
MDKIGRFGDFGGQYIPETVMTAVHELEAAYDKYKDDPEFNRELRELYRDYANRPSMLYYA
EKMTKDLGGAKVYIKREDLNHTGAHKINNVLGQLLLAKKMGKKRIIAETGAGQHGVATAT
VCALMGLECEVYMGSTDMERQSLNVYRMNLLGAKVTGVDSGTATLKDAINEAFRDWCSNI
DTTFYCIGSVMGPHPYPTMVRDFQKIISEEIKAQMLEKEGRLPDAVVACVGGGSNAMGAF
YDFIGDKGVRLIGAEAAGRGVDTPEHAATIAKGDLGIFHGMKSLFLQNEYGQIDEVYSIS
AGLDYPGIGPEHAYLHSIGRADYYSITDEEAVQAFEYLSKTEGVIPAIESAHAVAAAMKI
IPQMSKDQIVVINLSGRGDKDVYSIARYRGVELDEK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggataagataggacgcttcggcgatttcggcggacagtatatccccgaaacagtcatg
actgcagtacatgaactggaagccgcttacgacaaatacaaggacgaccctgagttcaac
agggagctgcgcgagctttaccgcgattacgcaaacagaccatcaatgctttattacgct
gagaagatgacaaaagatctcggcggcgctaaggtgtatatcaagagagaggatctcaac
cacacaggtgcccacaagataaacaatgttctgggtcagctgctgctggcaaagaagatg
ggaaaaaagcgtatcatcgccgaaacaggtgcaggtcagcacggcgttgctaccgctacc
gtatgcgcactgatgggtcttgaatgtgaagtatatatgggctcaaccgatatggaaaga
cagtccctgaacgtttacagaatgaacctgttgggtgctaaggtgacaggcgttgacagc
ggtacggcaactctgaaagacgctataaacgaagctttccgcgactggtgttcaaacatc
gacaccacattctactgcataggttccgttatgggacctcacccctaccccacaatggtg
cgcgatttccagaagataatcagcgaggagataaaggcacagatgcttgaaaaagagggc
aggcttcccgatgcagttgtagcctgcgtaggcggcggttcaaacgctatgggtgctttc
tatgatttcatcggcgataagggcgtaagacttatcggtgctgaggccgcaggcagagga
gttgatacacccgaacacgcggctaccatcgcaaagggcgaccttggtatattccacggt
atgaagtcactgttcttacagaatgagtacggacagatagatgaagtatattctatctcg
gctggacttgactaccccggtataggccccgaacacgcttatctgcattcaatcggcaga
gctgattattacagcataaccgatgaggaagctgtacaggcttttgaatacctctcaaag
accgagggcgttatccctgcgatagaatcagcccacgctgttgcggcagctatgaagatc
atcccccagatgagcaaagatcagatagtagttataaacctgtcgggcagaggagataag
gacgtttattcaatagcaagatacagaggagttgagttagatgaaaaatag

DBGET integrated database retrieval system