KEGG   Ruminococcus albus: Rumal_1845Help
Entry
Rumal_1845        CDS       T01387                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ral  Ruminococcus albus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ral00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2102821..2103759)
Genome map
AA seq 312 aa AA seqDB search
MLDKLKVINGKLTAGEKPVRLFGLSTHGIAWYPEYICEESFNALKKDWRTNCIRIAMYTD
EFRGYCKDGNKQHLKELIEKGVVIAEKLDMYVIVDWHVLCDQDPMKYIDEAEEFFSDMSK
RFANKTNVIYEICNEPNCSGTWDKITEYADRIIPIIRSNSPDALIVTGTSTWSQDIHCAL
EKPLKWDNVMYSLHFYAATHKGTLRSRLERCIEAGLPVFINEFNLCEASGKGDIDIDEAN
AWYEVIDRLGLSCISWCLSNSGDTCGVFTQNCTKLSGWTDEDIKTSGKIIKGWFEAFADE
ENTNEQCFRIDK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgttggataaacttaaagtaataaatggaaaactgacagccggtgagaaaccagtaaga
cttttcgggttatcaactcacggtatagcctggtatccggaatatatttgtgaagaatca
ttcaatgccctaaaaaaagactggcgtacaaactgtataaggatagcaatgtacacagac
gaattcagagggtactgcaaggacggcaacaaacagcatctgaaagagctgatcgagaaa
ggcgttgttattgcagaaaaactggatatgtatgtaatagtagactggcacgttctgtgt
gatcaggatccgatgaaatatattgatgaagctgaagagtttttcagtgatatgtcaaag
aggttcgccaataaaacaaacgttatatacgagatatgtaacgaacctaactgcagcggc
acatgggataaaataacagaatatgcagacaggataatcccgataatccgcagtaactcc
cccgatgcacttattgtcacaggaacatcaacgtggtcgcaggacatacactgtgcgctt
gaaaagccgctgaaatgggacaatgttatgtactctctgcatttctatgctgctacacac
aagggtacactgcgcagcagactggaacgatgtattgaagccgggcttccggtttttatc
aatgaattcaatctgtgtgaagctagcggtaagggcgatatcgatatagatgaagcaaat
gcatggtatgaggtaatagacagactcgggctgagctgcataagctggtgcctttcaaac
agtggagatacctgcggcgtttttacccaaaattgtacaaagctttcaggctggacggat
gaagatataaaaacatcgggcaaaataataaaaggctggtttgaggcatttgcagatgag
gagaatacaaatgaacaatgttttcgaattgataaatga

DBGET integrated database retrieval system