KEGG   Ruminococcus albus: Rumal_1854Help
Entry
Rumal_1854        CDS       T01387                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ral  Ruminococcus albus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ral00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ral00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2112135..2113223
Genome map
AA seq 362 aa AA seqDB search
MANLYNNLNLIDLNDFPVSWWEKLLDRAHDIMAEPSAYAEKCKGKIMGTLFYEPSTRTQM
SFQTAMLRLGGTIIGFDNPATSSVAKGENIKDTTKIVSGYADIMVMRHPVAGSVKAAALT
ADCPVINAGDGGHLHPTQTLTDLLTLKEEKGSLEGLCIGLCGDLKNGRTVHSLIKAMSCF
KGTSFVLISTPELALPAYIKDVLSAGGHPYKEVSSLDDAVGMLDVLYMTRIQRERFSSPE
EYEKQKGCYILDKRKMSKAKDSMIVMHPLPRVDEIAVEVDDDPRAMYFKQAKYGMYIRMA
LILTMLEEKEMKIPLVTGKIHTHQICSNPLCITHKENYLPHYFRGDSTMLECEYCDERTL
VE
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatctttacaacaacctcaatcttatcgaccttaatgattttcctgtcagctgg
tgggaaaaactgctggacagggcgcacgatataatggctgagccttcggcttatgctgaa
aaatgcaagggtaagataatgggtactttgttctatgaaccctcgaccaggactcagatg
tcttttcagacagctatgcttcgtctgggcggcacgattattgggtttgataaccctgct
acttcctctgtcgcaaagggtgagaatattaaagatactacgaagatagtttcgggatat
gcagacataatggtaatgaggcatcctgtggcaggttctgtaaaagcagcggctcttacg
gcagattgtcctgtgatcaatgccggtgacggcggacaccttcatccgacacagacactt
accgatcttcttacacttaaagaggaaaagggatcactggaaggactgtgcataggtctg
tgcggtgatctgaaaaacggcagaacggtacattctctgataaaggcaatgtcatgcttt
aaaggaaccagtttcgtgctgatatcaactcctgaacttgcacttcctgcttacataaaa
gatgttctttcagcaggcggtcatccttataaggaagtatcatcccttgatgatgctgtc
ggtatgctggatgttctgtatatgacaaggatacagagggaaaggttctctagtccggaa
gaatatgaaaagcagaagggctgttatatcctcgataaaagaaaaatgtctaaggctaag
gacagtatgatcgttatgcacccattaccaagagtagatgaaatcgcggtcgaggtcgat
gacgatccaagagctatgtatttcaagcaggctaaatacggtatgtatatccgcatggcc
cttatactcaccatgcttgaagagaaggaaatgaagataccgctggtgacaggaaagata
catacccatcagatatgttcaaatccattgtgtataactcataaggaaaattatctgcct
cattatttcaggggcgacagcactatgcttgaatgtgaatactgcgacgagaggacgctt
gtggaataa

DBGET integrated database retrieval system