KEGG   Ruminococcus albus: Rumal_1924Help
Entry
Rumal_1924        CDS       T01387                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K13940  dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
ral  Ruminococcus albus
Pathway
ral00790  Folate biosynthesis
ral01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rumal_1924
Enzymes [BR:ral01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Rumal_1924
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     Rumal_1924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK FolB
Motif
Other DBs
NCBI-ProteinID: ADU22418
JGI: Rumal_1924
UniProt: E6UAJ6
Position
2182533..2183351
Genome map
AA seq 272 aa AA seqDB search
MDKICIEELRIFAHHGVFEHENINGQNFYVNSALYVDTEKAGMNDDLESSVDYSKVCELL
EKVMTENTFKLIETVAQKAAETILMEYPIVSAVDLEIRKPEAPIDMDFSSVSVKIHRGWH
RVLLSLGSNMGDSRGYLENAFEKLRECPYIRNVKCSELIITKPYGYTEQADFVNGAVICE
TMLSPHGLLELTQSLENSADRRREIHWGPRTLDVDIVFYDDEVISDPDLIIPHPDMHNRE
FVLAPAAEIASYYRHPISGKTVSQLLAELAKQ
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtggataagatatgtattgaagaactgagaatatttgcgcatcacggagtatttgaacat
gaaaatataaacggacagaatttctatgtcaactccgcgctgtatgtagatacagaaaaa
gccgggatgaacgatgatctggaaagctccgtggattacagcaaagtatgcgaacttctt
gaaaaggtaatgacagaaaataccttcaagctgattgaaactgtcgcacagaaagccgct
gaaactattctcatggaatatccgatcgtcagtgctgttgatttggagatacgcaaacct
gaagctcctatagatatggatttcagctcagtatcagttaagatacacagaggatggcat
agagttcttctctctctcgggtcaaatatgggtgacagcaggggataccttgaaaatgct
tttgaaaagctgcgtgagtgtccttatatacgaaatgtaaaatgctccgagcttattata
accaagccttatggttatacagaacaagctgattttgttaatggtgcagtgatatgtgag
acaatgctcagccctcacggattgcttgaattgacgcagtccttagaaaattcagctgac
cgcagacgtgagatacactggggaccgcgcacccttgatgtggatattgtgttctatgac
gatgaagttatatctgatcctgatctgataataccgcatcctgatatgcataaccgtgaa
tttgtactcgcaccggcagctgagatagcatcctattaccgccacccaatatcaggtaaa
acagtttcacagctccttgctgagttggcaaaacaatga

DBGET integrated database retrieval system