KEGG   Ruminococcus albus: Rumal_1925Help
Entry
Rumal_1925        CDS       T01387                                 

Definition
(GenBank) dihydrofolate reductase region
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
ral  Ruminococcus albus
Pathway
ral00670  One carbon pool by folate
ral00790  Folate biosynthesis
ral01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rumal_1925
   00670 One carbon pool by folate
    Rumal_1925
Enzymes [BR:ral01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Rumal_1925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ADU22419
JGI: Rumal_1925
UniProt: E6UAJ7
Position
2183348..2183839
Genome map
AA seq 163 aa AA seqDB search
MICIIAAVAANGIIGSNGGIPWDIPEDRHYFRNITEDGVLIMGRRTYESIGRPLPGRYNI
VISRNTDYTGSMLRTVANLEEAIKAAERYVQRKRKGDIFLCGGAEIYRQGLAFTKKLYLT
ELYDEYEGDVYFPEFNRDEFGCVSCDEHHELGLRFCVYERLNK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgatatgcattatcgcggcagtagccgctaacggtataattggctcaaatggaggtatc
ccctgggatattcctgaagacagacattatttcagaaatatcactgaggatggtgtcttg
attatgggcagacgtacctatgagagcatcggcagaccgctgcccggaaggtacaatatt
gttatttcacgcaatacagactacacaggcagtatgctcagaacagtagcgaaccttgaa
gaggctatcaaagcagcagaaagatatgttcaacgcaaaaggaaaggggatatattcctc
tgtggaggtgctgagatataccgtcagggacttgcttttacgaaaaaattgtatctgacc
gaactttatgacgaatatgaaggcgatgtgtatttcccagagttcaatcgtgacgagttc
ggctgtgtgagctgtgatgaacaccatgagctcggactacggttttgtgtctatgagcgt
ttaaataaatag

DBGET integrated database retrieval system