KEGG   Ruminococcus albus: Rumal_1925Help
Entry
Rumal_1925        CDS       T01387                                 

Definition
dihydrofolate reductase subunit
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ral  Ruminococcus albus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ral00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ral00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2183348..2183839
Genome map
AA seq 163 aa AA seqDB search
MICIIAAVAANGIIGSNGGIPWDIPEDRHYFRNITEDGVLIMGRRTYESIGRPLPGRYNI
VISRNTDYTGSMLRTVANLEEAIKAAERYVQRKRKGDIFLCGGAEIYRQGLAFTKKLYLT
ELYDEYEGDVYFPEFNRDEFGCVSCDEHHELGLRFCVYERLNK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgatatgcattatcgcggcagtagccgctaacggtataattggctcaaatggaggtatc
ccctgggatattcctgaagacagacattatttcagaaatatcactgaggatggtgtcttg
attatgggcagacgtacctatgagagcatcggcagaccgctgcccggaaggtacaatatt
gttatttcacgcaatacagactacacaggcagtatgctcagaacagtagcgaaccttgaa
gaggctatcaaagcagcagaaagatatgttcaacgcaaaaggaaaggggatatattcctc
tgtggaggtgctgagatataccgtcagggacttgcttttacgaaaaaattgtatctgacc
gaactttatgacgaatatgaaggcgatgtgtatttcccagagttcaatcgtgacgagttc
ggctgtgtgagctgtgatgaacaccatgagctcggactacggttttgtgtctatgagcgt
ttaaataaatag

DBGET integrated database retrieval system