KEGG   Ruminococcus albus: Rumal_2185Help
Entry
Rumal_2185        CDS       T01387                                 

Definition
(GenBank) glycoside hydrolase family 4
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
ral  Ruminococcus albus
Pathway
ral00052  Galactose metabolism
ral00561  Glycerolipid metabolism
ral00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Rumal_2185
  Lipid metabolism
   00561 Glycerolipid metabolism
    Rumal_2185
   00600 Sphingolipid metabolism
    Rumal_2185
Enzymes [BR:ral01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Rumal_2185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ADU22671
JGI: Rumal_2185
UniProt: E6UC49
Position
complement(2448155..2449561)
Genome map
AA seq 468 aa AA seqDB search
MKTIKIAYIGGGSKMWARVFMNDLALTEGLGGEIALYDIDFEAAELNRRIGEKINACNDT
ITKWDYKVYPDIGSALDGADFVICSILPGTFDEMEYDVHLPEKYGIYQSVGDTVGPGGVL
RAMRTVPIYEGFAKAIKKYCPDAWVINLTNPMTACTKTLYDVFPEIKAFGCCHEVFHAQE
FLCCVVSDMLVIPRPSRQEINIDACGVNHFTWITEANYKGTDLFSLLPAFIDKYYESGYC
EREGVAPDGFKNDPFLYGNKVKMDLFRRFGILAAAGDRHLVEFMNSAWYIKDKASVDKWL
YHLTEVSYRKKDMAEKIARSHRLADGTESISLNRSDEEVVELMKALLGLIPPKVSNANVP
NVGQMPQMPLGSVVETNCVFSHNSLKPITSRKLPEDVSALVLRNALNIENTYYGIKNRDL
NRLFEAFIAQPLCSALSITEARELFSSMVDGTRYYLEPWFSDKELTLC
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacaataaaaatagcttatatcggcggcggttctaaaatgtgggcaagggtgttt
atgaatgatcttgctctcactgaaggtcttggtggagagatagctctttatgatattgac
tttgaagcagctgaacttaacaggcgtataggtgaaaagataaatgcctgcaatgataca
ataacgaagtgggattataaggtatatcctgatatcggcagtgcccttgacggcgctgac
tttgtgatatgctccatacttccgggtacatttgatgagatggagtatgatgttcatctc
cctgaaaaatatggaatatatcaatcggtcggtgatactgtcggaccgggcggtgttctt
cgtgctatgcgtacagtcccgatatatgaaggcttcgctaaggcgatcaagaaatattgt
ccggatgcatgggtgattaatctgactaatcccatgacagcctgcacaaagacactttac
gatgttttcccggagatcaaagcctttggctgctgtcacgaggtattccatgcacaggag
ttcctttgctgtgtagtaagtgatatgctggttattccaagaccttccagacaggagatc
aatattgatgcctgcggtgtaaatcattttacctggatcaccgaagctaactataaaggc
acagatcttttcagtctgctccccgcattcatagataaatactacgagagcggttactgc
gagcgtgagggagtagcacctgatggttttaagaatgatccgtttttgtacggcaacaaa
gtcaagatggatctgttcaggcgctttggtatactggcagctgcaggtgacaggcacctt
gttgaattcatgaacagtgcctggtacataaaggataaggcttctgtggacaaatggctt
tatcatcttactgaggtaagctatcgtaaaaaggatatggctgaaaagatagctcgttca
catcgtcttgctgatggtacggaaagcatcagtctgaaccgcagtgatgaagaagtagta
gagcttatgaaggcactgcttggtttgataccgcccaaggtatcaaatgcaaatgtcccg
aatgttggacagatgccgcaaatgcctttgggttcagtcgttgagacaaactgtgtattc
tcgcataacagcctgaagcccataacatcaagaaagcttcccgaggatgtaagcgcgctt
gtccttcgcaacgcattgaatatcgagaatacttactatggtataaagaaccgtgatctg
aacagattgtttgaggctttcatagctcagccgctttgcagtgctctttctataactgaa
gcacgtgaactgttcagcagcatggttgacggtacaaggtattatcttgaaccatggttt
tctgataaagagctgacactatgctag

DBGET integrated database retrieval system