KEGG   Ruminococcus albus: Rumal_2200Help
Entry
Rumal_2200        CDS       T01387                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ral  Ruminococcus albus
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rumal_2200
   00500 Starch and sucrose metabolism
    Rumal_2200
Enzymes [BR:ral01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Rumal_2200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2463141..2464055)
Genome map
AA seq 304 aa AA seqDB search
MNVVKLSSDMSISKAIRSAEKGTRFILAPGTYREKIEITVPDIEIVGDIAGETKIVWDDY
ATKPDEKGVEYNTFRTYTVAVLAPRVTFRNITVENDALYPEIKGQEVALTVCADGFRAYN
CRFISTQDTVFCGPLPSDLIIRYYGFLKSTLRAGGTMRQIFRDCFIAGNVDFIFGCATAL
FDRCEIHSVYDVRGHGFTAAPAHGYEQKVGFVFNECIFTCEDKVPDGSVYLARPWRDHGK
CTFIDCTYGRHIAAAGFDSWNDSGRDKTARFAEYGRIPSDRVPWSTVIGDDEMRQLLKAF
DQEV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttgtaaaattatcatctgacatgagcatttccaaggcgatcagatcggctgaa
aagggtacgcggtttatacttgcacccggtacatatcgagagaagatcgagataactgtg
cctgatatcgaaatagttggtgatattgccggagaaacaaagatagtatgggatgactat
gcaaccaagccggatgaaaaaggggtagaatacaacacgttcaggacatatacagtcgct
gtgctggctccgcgggtgactttccgcaatatcacagttgaaaatgatgccctttatccc
gagataaagggtcaggaggtcgcacttactgtgtgtgccgacggcttcagggcttataac
tgccgttttatctcaactcaggatactgtgttctgcggaccgctgccatcagatctgata
atcagatattacggctttctgaaaagcacgcttcgtgcaggcggtaccatgaggcagata
ttcagggactgttttatcgcaggtaatgtggattttatattcggctgtgccaccgctctc
tttgacagatgtgagatccattctgtttatgacgtaagagggcatgggttcacagcagca
cctgcacatggatatgaacaaaaggttggtttcgtgttcaatgagtgcatatttacctgt
gaagataaagttccggatggctctgtctatcttgcccgcccgtggagagatcacggtaag
tgtacgtttattgattgtacatacggcagacatatcgctgcggcaggcttcgacagctgg
aacgactcgggcagggataagactgccagatttgctgagtacggtcgtatcccgtcggac
cgtgttccgtggagcactgttatcggtgatgatgagatgaggcagcttttgaaagctttt
gatcaggaggtgtaa

DBGET integrated database retrieval system