KEGG   Ruminococcus albus: Rumal_2200Help
Entry
Rumal_2200        CDS       T01387                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ral  Ruminococcus albus
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ral00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ral00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2463141..2464055)
Genome map
AA seq 304 aa AA seqDB search
MNVVKLSSDMSISKAIRSAEKGTRFILAPGTYREKIEITVPDIEIVGDIAGETKIVWDDY
ATKPDEKGVEYNTFRTYTVAVLAPRVTFRNITVENDALYPEIKGQEVALTVCADGFRAYN
CRFISTQDTVFCGPLPSDLIIRYYGFLKSTLRAGGTMRQIFRDCFIAGNVDFIFGCATAL
FDRCEIHSVYDVRGHGFTAAPAHGYEQKVGFVFNECIFTCEDKVPDGSVYLARPWRDHGK
CTFIDCTYGRHIAAAGFDSWNDSGRDKTARFAEYGRIPSDRVPWSTVIGDDEMRQLLKAF
DQEV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttgtaaaattatcatctgacatgagcatttccaaggcgatcagatcggctgaa
aagggtacgcggtttatacttgcacccggtacatatcgagagaagatcgagataactgtg
cctgatatcgaaatagttggtgatattgccggagaaacaaagatagtatgggatgactat
gcaaccaagccggatgaaaaaggggtagaatacaacacgttcaggacatatacagtcgct
gtgctggctccgcgggtgactttccgcaatatcacagttgaaaatgatgccctttatccc
gagataaagggtcaggaggtcgcacttactgtgtgtgccgacggcttcagggcttataac
tgccgttttatctcaactcaggatactgtgttctgcggaccgctgccatcagatctgata
atcagatattacggctttctgaaaagcacgcttcgtgcaggcggtaccatgaggcagata
ttcagggactgttttatcgcaggtaatgtggattttatattcggctgtgccaccgctctc
tttgacagatgtgagatccattctgtttatgacgtaagagggcatgggttcacagcagca
cctgcacatggatatgaacaaaaggttggtttcgtgttcaatgagtgcatatttacctgt
gaagataaagttccggatggctctgtctatcttgcccgcccgtggagagatcacggtaag
tgtacgtttattgattgtacatacggcagacatatcgctgcggcaggcttcgacagctgg
aacgactcgggcagggataagactgccagatttgctgagtacggtcgtatcccgtcggac
cgtgttccgtggagcactgttatcggtgatgatgagatgaggcagcttttgaaagctttt
gatcaggaggtgtaa

DBGET integrated database retrieval system