KEGG   Ruminococcus albus: Rumal_2200Help
Entry
Rumal_2200        CDS       T01387                                 

Definition
(GenBank) Pectinesterase
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
ral  Ruminococcus albus
Pathway
ral00040  Pentose and glucuronate interconversions
ral01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rumal_2200
Enzymes [BR:ral01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Rumal_2200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pectinesterase DUF1565
Motif
Other DBs
NCBI-ProteinID: ADU22686
JGI: Rumal_2200
UniProt: E6UC64
Position
complement(2463141..2464055)
Genome map
AA seq 304 aa AA seqDB search
MNVVKLSSDMSISKAIRSAEKGTRFILAPGTYREKIEITVPDIEIVGDIAGETKIVWDDY
ATKPDEKGVEYNTFRTYTVAVLAPRVTFRNITVENDALYPEIKGQEVALTVCADGFRAYN
CRFISTQDTVFCGPLPSDLIIRYYGFLKSTLRAGGTMRQIFRDCFIAGNVDFIFGCATAL
FDRCEIHSVYDVRGHGFTAAPAHGYEQKVGFVFNECIFTCEDKVPDGSVYLARPWRDHGK
CTFIDCTYGRHIAAAGFDSWNDSGRDKTARFAEYGRIPSDRVPWSTVIGDDEMRQLLKAF
DQEV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttgtaaaattatcatctgacatgagcatttccaaggcgatcagatcggctgaa
aagggtacgcggtttatacttgcacccggtacatatcgagagaagatcgagataactgtg
cctgatatcgaaatagttggtgatattgccggagaaacaaagatagtatgggatgactat
gcaaccaagccggatgaaaaaggggtagaatacaacacgttcaggacatatacagtcgct
gtgctggctccgcgggtgactttccgcaatatcacagttgaaaatgatgccctttatccc
gagataaagggtcaggaggtcgcacttactgtgtgtgccgacggcttcagggcttataac
tgccgttttatctcaactcaggatactgtgttctgcggaccgctgccatcagatctgata
atcagatattacggctttctgaaaagcacgcttcgtgcaggcggtaccatgaggcagata
ttcagggactgttttatcgcaggtaatgtggattttatattcggctgtgccaccgctctc
tttgacagatgtgagatccattctgtttatgacgtaagagggcatgggttcacagcagca
cctgcacatggatatgaacaaaaggttggtttcgtgttcaatgagtgcatatttacctgt
gaagataaagttccggatggctctgtctatcttgcccgcccgtggagagatcacggtaag
tgtacgtttattgattgtacatacggcagacatatcgctgcggcaggcttcgacagctgg
aacgactcgggcagggataagactgccagatttgctgagtacggtcgtatcccgtcggac
cgtgttccgtggagcactgttatcggtgatgatgagatgaggcagcttttgaaagctttt
gatcaggaggtgtaa

DBGET integrated database retrieval system