KEGG   Ruminococcus albus: Rumal_2486Help
Entry
Rumal_2486        CDS       T01387                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ral  Ruminococcus albus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rumal_2486
   01230 Biosynthesis of amino acids
    Rumal_2486
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rumal_2486
   00030 Pentose phosphate pathway
    Rumal_2486
   00051 Fructose and mannose metabolism
    Rumal_2486
   00052 Galactose metabolism
    Rumal_2486
  Energy metabolism
   00680 Methane metabolism
    Rumal_2486
Enzymes [BR:ral01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Rumal_2486
Protein phosphatases and associated proteins [BR:ral01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Rumal_2486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2803713..2804675
Genome map
AA seq 320 aa AA seqDB search
MAKKIGVLTSGGDAPGMNAAVRAVCRTALQRGMEVVGIERGYNGLLNGEIVEMNARTVSG
IIQRGGTCLYTARCPEFKTKEGVAKGAEKCREIGLDGIVVIGGDGSFRGAADLSSMGIPC
IGLPGTIDNDISCTEYTIGYDTAMNTAMEMIDKIKDTAQSHDRCSVVEVMGRNAGYIAVN
VGVAVGAEAVITPEKDYDLDAICTKIQNTMKSGKNHFVVVVAEGVGKTDEITKIISEKTG
VETRATILGHVQRGGSPTVRDRVVATQMGHHAVELLEKGIGNRVVGMKDNHVYDVDIQEA
LSMKKPFEEELYGILNETAF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaaatcggtgttctcacaagcggcggcgatgcgcccggaatgaacgctgct
gttagagcagtatgcagaacagctcttcagagaggcatggaagttgtaggtatagagcgc
ggatacaacggtctgctgaacggcgagatcgttgagatgaatgcaaggactgtatccggt
atcatccagagaggcggtacttgcctatatacagccagatgccctgagttcaagactaaa
gagggcgttgcaaagggtgctgagaagtgccgtgagatcggtctggacggcatcgttgtt
atcggcggtgacggatccttcagaggcgcagctgacctttcttcaatgggtatcccctgc
ataggtcttcccggaactatcgacaacgatatatcctgcactgagtataccatcggttat
gataccgctatgaacaccgctatggaaatgatcgacaagatcaaggatactgcacagtcc
cacgacagatgctctgttgttgaggtaatgggcagaaatgcaggttacatagctgtaaac
gttggtgttgctgtaggtgctgaggctgttatcactcctgagaaggactatgaccttgac
gctatctgcaccaagatccagaatacaatgaagagcggcaagaaccacttcgttgtagtt
gtagctgagggcgttggcaagaccgatgagatcactaagatcatcagcgagaagacaggc
gttgaaacaagagctactatcctcggtcacgttcagagaggcggctcccctaccgttcgt
gacagagttgttgcaacacagatgggtcaccacgctgttgaactgctcgagaagggtatc
ggcaacagagttgtcggcatgaaggataaccacgtatatgacgttgatatccaggaagca
ctgtccatgaagaagcctttcgaggaagaactttacggtatactgaacgaaactgcattc
tga

DBGET integrated database retrieval system