KEGG   Ruminococcus albus: Rumal_2567Help
Entry
Rumal_2567        CDS       T01387                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ral  Ruminococcus albus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ral00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Rumal_2567
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rumal_2567
Enzymes [BR:ral01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Rumal_2567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2886542..2887831
Genome map
AA seq 429 aa AA seqDB search
MEKFFIRGGHPLKGTVYVSGAKNAAVALVAATILCDEPCTLENVPAISDITKCLDILKSM
GAVVKMEREGVIYIDTSTITTTKVPYKLAETMRASSYFLGTLLGRFHEAFVPMPGGCYLG
DRPIDQHLKAFKALGATDEVVRGANYVKADKLVGNQIYFDFVTVGATMNAIFAAVKAKGQ
TIIENAAKEPHIVDVANFLNSMGADIRGAGTDVIKIRGVEYLHGTTYATIPDQIEAGTYM
VAAAATKGDVVVANVIPKHLESITAKLRKCGVNVEENDESVHVWVDSPLMNTTVKTQPHP
GFPTDMQPQFSTLLTMAQGTSKVTEEIFNNRFRYVAELRKMGADVSVEGGKVAIIQGVPT
LKGAPVQATDLRAGAALVIAGLAADGLTEIDNIHYIERGYECIDVKLRELGADIQRVIVP
DNENVVLSS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
ttggagaagttctttatcaggggaggtcatccccttaaaggcacagtgtatgtgagcggt
gctaagaatgccgcagttgcactggttgccgctactattttatgcgatgaaccctgtacg
cttgaaaacgttcccgctataagcgatatcacaaaatgtcttgatatccttaaaagcatg
ggcgctgttgtgaagatggagagagagggtgtcatatatattgacaccagcaccatcacc
accacaaaggtaccctacaagctggcggaaacaatgagagcgtcaagttattttcttggc
accttgcttggcaggttccatgaagcttttgttcccatgcccggcggatgctatcttggc
gacagacctattgaccagcatttaaaggctttcaaggctctgggcgctactgatgaggta
gtgagaggggctaattacgtcaaggcggacaagctggtgggcaaccagatctactttgat
tttgtaactgttggcgctacgatgaatgcgatcttcgctgctgttaaggcgaagggacag
accattatcgagaacgctgcgaaggagcctcatatagttgatgtagctaatttcctcaac
tctatgggcgctgatataagaggtgcaggcaccgacgttatcaagataagaggcgttgag
tacctccacggcaccacctatgctactatccccgaccagatcgaggcaggcacttatatg
gtagctgctgccgcaacaaagggcgatgtagtcgtggctaacgttatacccaagcatctt
gaatccataacagccaagctgcgcaagtgcggtgtaaatgttgaggagaacgacgagagc
gttcatgtatgggtagattcaccgcttatgaacaccaccgtcaaaactcagcctcacccg
ggtttccctactgatatgcagccgcagttctcaacactgctgaccatggctcagggtacc
agcaaggtgactgaggagatattcaacaacagattcagatacgttgccgagcttcgcaaa
atgggtgctgatgtatccgttgaaggcggaaaggtagcgataatacagggtgttcctaca
ctgaagggagctcccgtacaggcgaccgacctgagagcaggtgctgcgctcgttatcgca
ggtcttgcggcagacggtctgacagagatagacaatatccactacatcgagcgcggatat
gagtgcatagatgtcaagctcagagaactgggcgctgacatacagcgtgtcatcgttcct
gacaacgagaacgttgtgctcagcagctga

DBGET integrated database retrieval system